SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011842 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011842
Domain Number 1 Region: 156-299,330-405
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.33e-22
Family Protein prenylyltransferase 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011842
Domain Number - Region: 332-589
Classification Level Classification E-value
Superfamily TPR-like 0.000443
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011842   Gene: ENSPANG00000021030   Transcript: ENSPANT00000005643
Sequence length 863
Comment pep:known_by_projection chromosome:PapAnu2.0:1:218078326:218149267:1 gene:ENSPANG00000021030 transcript:ENSPANT00000005643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWPPGCIRCTCFWGGAVAAAGAARRVLLLLLLGVLSAVPRPGALATEHYSPLSLLKQELQ
HRQQQEAPAGGGGCSPQSGDWGDQYSAECGESSFLNFHDSDCEPKGSPPCDSLLSLNTEK
ILSQAKSIAEQKRFPFATDNDSTNEELAIAYVLIGSGLYDEAIVRHFSSSLQEEPDLVSA
IYGRGIAYGKKGLHDIKNAELALFELSRVITLEPDRPEVFEQRAEILSPLGRINEAVNDL
TKAIQLQPSARLYRHRGTLYFISEDYATAHEDFQQSLELNKNQPIAMLYKGLTFFHRGLL
KKHTQEEPQKVVLNENLKAVKKFSSVWQIPRELGNFEAATESFQKALLLNQNHVQTLQLR
GMMLYHHGSLQEALKNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDPL
PGQKASPEYLKVKYLREYSRYLHAHLDTPLTEYNIDVDLPGSFKDHWAKNLPFLIEDYEE
QPGLQPHIKDVLHQNFESYKPEVQELICVADRLGSLMQYETPGFLPNKRIHRAMGLAALE
VMQAVQRTWTNSKVRMNGKTRLMQWRDMFDIAVKWRRIADPDQPVLWLDQMPARSLSRGF
NNHINLIRGQVINMRYLEYFEKILHFIKDRILVYHGANNPKGLLEVREALEKVHKVEDLL
PIMKQFNTKTKDGFTVNTKVPSLKDQGKEYDGFTITITGDKVGNILFSVETQTTEERTQL
YHAEIDALYKDLTAKGKVLILSSEFGEADAVCNLILSLVYYFYNLMPLSRGSSVIAYSVI
VGALMASGKEVAGKIPKGKLVDFEAMTAPGSEAFSKVAKSWMNLKSISPSYKTLPSVSET
FPTLRSMIEVLNTDSSPRCLKKL
Download sequence
Identical sequences ENSPANP00000011842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]