SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011848 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011848
Domain Number 1 Region: 189-464
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.92e-73
Family Mitochondrial carrier 0.0000625
Further Details:      
 
Domain Number 2 Region: 14-183
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000934
Family Polcalcin 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011848   Gene: ENSPANG00000014086   Transcript: ENSPANT00000028862
Sequence length 472
Comment pep:novel chromosome:PapAnu2.0:1:109173844:109236037:1 gene:ENSPANG00000014086 transcript:ENSPANT00000028862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWMQGFVLEAVACQDDEDYLRYGILFEDLDRNGDGVVDITELQEGLRNWSSAFDPNSE
EVVARSPNHLDSSLGIEEIESLLHIIKDNTECPFKPVDLDYVLDWITVNGSVRRKGFYLK
MSQYENTNFSMDTDGSMTVDWDEWKYYFLLHPAKNVTEIIHFWKRSTLIDIGESIAIPDE
FTEQEKQSGDWWKRLVSAGIASAVARTFTAPLDRLKVMMQVHSLKSRKMRLISGLEQLVK
EGGIFSLWRGNGVNVLKIAPETALKVGAYEQYKKLLSFDGVHLGILERFISGSLAGVTAQ
TCIYPMEVLKTRLAIGKTGEYSGIIDCGKKLLKQEGVRSFFKGYTPNLLGIVPYAGIDLA
VYEILKNYWLENYSGNSVNPGIMILVGCSTLSNTCGQLASFPVNLIRTHMQASALVEKGK
TTSMIRLIQEIYTKEGKLGFYRGFTPNIIKVLPAVGIGCVAYEKVKSLFGLT
Download sequence
Identical sequences ENSPANP00000011848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]