SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011862 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011862
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000148
Family SAM (sterile alpha motif) domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011862
Domain Number - Region: 722-869
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000363
Family Nitrogenase iron protein-like 0.073
Further Details:      
 
Domain Number - Region: 1071-1128
Classification Level Classification E-value
Superfamily TPR-like 0.0632
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011862   Gene: ENSPANG00000011875   Transcript: ENSPANT00000000456
Sequence length 1588
Comment pep:known_by_projection chromosome:PapAnu2.0:3:108888246:108893012:1 gene:ENSPANG00000011875 transcript:ENSPANT00000000456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKQLNLPQNTDDWTKEDVNRWLESHKIDQKHREILTGQDVNGAVLKWLKKEHLVDMGIT
HGPAIQIEELFKELQKTAIEDSIQTSKMRKPSKNAPKDQTVSQKESRETSKQKQKDKENP
DMANPSTMSTIAKVSESLKVELIEDKIDYTKERQPSIDLTCVSYPFDEFSNPYRYKLDFI
LQPETGPGNLIDPIHEFKAFTNTETATEEDVKMKFSNEVFRFASACMNSRTNGTIHFGVK
DKPHGKIVGVKVTSDTKEALINHFNLMINKYFEDHQVQQAKKCIREPRFVEVLLPNSTLS
DRFVIEVDIIPQFSECQYDYFQIKIQNYNNKTWEQSKKFSVFVRDGTSSKDIMKNKADFR
TFKADFKTLAESRKAAEEKFRAKTNKKEREGPKLVKLLTGNQDLLDNSYYEQYILVTNKC
HPDQTKHLDFLKEIKWFAVLEFDPESNINGVVQDYKASRVANLHFPSIYVEGKTTPNEKI
STLNLYHQPSWIFCNGRSDLDSEKYKPFDPSSWQRERASDVRKLISFLTHEDIMPRGKFL
VVFLLLSSVDDPRDPLIETFCAFYQDLKGIENILCICVQPHIFQGWKDLLEARLIKHQDE
ISSQCISALSLEEINGTILKLKSVTQSSKRLLPSIGLSTVLLKKEEDIMTSLEIICENEC
EGTLLEKDKNKFLEFKASKEEDFYRGGKVSWWNFYFSSESYSSAFVKRDKYERLEAMIQN
CADSSKPTCTKIIHLYHHPGCGGTTLAMHILWDLRKKFRCAVLKNKTVDFSEIGEQVTNL
ITYGAMNRQDYVPVLLLVDDFEEQDNVYLLQYSIQTAIAKKYIRYEKPLVIILNCMRSQN
PEKSARIPDSIAVIQQLSPKEQRAFELKLKEIKEQHKNFEDFYSFMIMKTNFNKEYIENV
VRNILKGQNIFTKEAKLFSFLALLNSYVPDTTISLSQCERFLGIGNKKAFWGTEKFEDKM
GTYSTILIKTEVIECGNYCGVRIIHSLIAKFSLEELKKSYHLNKSQIMLDMLTENLFFDT
GMGKSKFLQDMHTLLLTRHRNEHEGETGNWFSPFIEALHKDEGNEAVEAVLLEGIHRFNP
NAFICQALARHFYIKKKDFGNALNWAKQAKIIEPDNSYISDTLGQVYKSKIRWWIEENGR
NGNISVDDLIALLNLAEQASSAFKESQQQSEYREYEVKERLYQKSKRRYDTYNTAGYQGE
IEVGLYTIQILQLIPFFDNKNELSKRDMVNFVSGSGDIPGDQNDEYKLALKNYIPYLTKL
KFSLKKSFDFFDEYFVLLKPRNNIKQNEEAKTRKKVAVNFKKYTDIFCLLEESQDIGLGS
KFSEPLQIERCRKSLVALKADKFSGLLEYLIKSQEDAISTMEDIVNKYAFLLEQCTVKIQ
AKEKLNFILANIILSCIKPTSTLVKPVEKLKDQLREVLQPIGLTYRFSEPYFLASLLFWP
ENQQLDQHSQQMKEYAQALENSFKGQYKHMHRTKQPIAYFFLGKGKRLKRLVHKGKIDQC
FENTRDINSLWQSGDVWKEEKVQELLLRLQGRAENNCLYIEYGINEKITIPITPTFLGQL
RSGRSIEKVSFYLGFSIGGPLAYDIEIV
Download sequence
Identical sequences A0A096NG04
ENSPANP00000011862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]