SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011874 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011874
Domain Number 1 Region: 2224-2402,2434-2570
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.45e-88
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 583-1084,1140-1369
Classification Level Classification E-value
Superfamily ARM repeat 1.81e-47
Family HEAT repeat 0.034
Further Details:      
 
Domain Number 3 Region: 1235-1365,1392-1494,1543-1584,2042-2200
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000936
Family RPA1889-like 0.069
Further Details:      
 
Domain Number 4 Region: 1711-1735,1913-1990
Classification Level Classification E-value
Superfamily TPR-like 0.00000734
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011874
Domain Number - Region: 53-386
Classification Level Classification E-value
Superfamily ARM repeat 0.0089
Family HspBP1 domain 0.094
Further Details:      
 
Domain Number - Region: 1709-1812
Classification Level Classification E-value
Superfamily TPR-like 0.0474
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011874   Gene: ENSPANG00000005574   Transcript: ENSPANT00000005465
Sequence length 2644
Comment pep:known_by_projection chromosome:PapAnu2.0:2:143534347:143656957:1 gene:ENSPANG00000005574 transcript:ENSPANT00000005465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEHGVELASMIPALRELGSATPEEYNAVVQKPRQILCQFIDRILTDVNVVAVELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVNGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH
KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVISRFLS
QLDEHMGYLQSAPLRLISMQNLEFIEVTLLTVLTRIIAIVFFRRQELLLWQIGCVLLEYG
SPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLVEMDTDQLKLYEEPLSKLIK
TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAG
YESALQVRKVYVTNICKALLDVLGIQVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL
SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVNMNQKSVLWSALKQKAESLQISLEYS
GLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCPTFKDCQHKSKKKPSVVITWMSLDFY
TKVLKSCRSLLETVQKPDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIY
SHSDDGCLKLTTFATNLLTLSHRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWAL
QSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSDIIKKEFASILGQLVCTLHG
MFYLTSSLTEPFSEHEHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKTPSAVKL
AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG
FIKELFVLRMKEAYTHAQISRNYELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSTPCQNADMR
KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LKKIKAILQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVIETGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGP
GHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYL
ITKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKH
DDQHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSLV
STVDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQK
LYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHG
VVKSMLGLGQLSTVITQVNGVHANSRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKS
TTWSVRLGQLLLSAKKRDITAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHML
CELEHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYD
EMVGECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQ
KGVELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWED
GHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDY
GTKAYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVF
VVLMEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATR
LTDKLLELCNKPVDGSSSTLSMSTHFKMLKKLVGEATFSEILIPLQSVMIPTLPSILGTH
ANHASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCR
LMEFNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEK
GVYMTGKELRQCMLPKSAALSEKLKVFQEFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAY
CRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTH
NMVNGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPL
NETGEVVNEKKHVQAVDVESILQASKSVSQVNCICSLLFLYLLLQKGYCENLLCQMYLGW
TPYM
Download sequence
Identical sequences ENSPANP00000011874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]