SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011895 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011895
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.6e-47
Family Phosducin 0.0000000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011895   Gene: ENSPANG00000007957   Transcript: ENSPANT00000009704
Sequence length 194
Comment pep:known_by_projection chromosome:PapAnu2.0:1:177894858:177897501:1 gene:ENSPANG00000007957 transcript:ENSPANT00000009704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYG
FVYELETGEQFLETIEKEQKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKA
SSTGAGDRFSLDVLPTLLIYKGGELISNFISVADQFAEEFFAGDVESFLNEYGLLPEREV
HALEHTKIEEEDIE
Download sequence
Identical sequences ENSPANP00000011895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]