SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011899 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011899
Domain Number 1 Region: 301-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.19e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000266
Further Details:      
 
Domain Number 2 Region: 122-300
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.44e-43
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00067
Further Details:      
 
Domain Number 3 Region: 601-707
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.51e-25
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000698
Family TGS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011899   Gene: ENSPANG00000016774   Transcript: ENSPANT00000028090
Sequence length 718
Comment pep:known_by_projection chromosome:PapAnu2.0:1:124255028:124275269:1 gene:ENSPANG00000016774 transcript:ENSPANT00000028090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLYQRWRRLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWSAQVKRLASIAQKEPRT
IKISLPGGQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGNGRTVRGSELPV
LEQICQELTAAAQPFRRLEASRDQLRQLFKDNPFKLHLIEERVTGPTATVYGCGTLVDLC
QGPHLRHTGQIGGLKLLSNSSSLWKSSGAPETLQRVSGISFPTTELLRAWEAWREEAELR
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTK
LWEQSGHWEHYQEDMFAVQPSGSDRPASSQSDDSTRHTTDILALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLR
SVYAILGFSFRLALSTRPSGFLGDPCLWDQAEQVLQQALKEFGEPWDLNSGDGAFYGPKI
DVHLHDARGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLA
ESCGGKWPLWLSPFQVVVIPVGTEQEEYAREAQQSLRAAGLVSDLDADCGLTLSRRIRRA
QLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNMRVPNAEEIF
Download sequence
Identical sequences A0A096NG37
ENSPANP00000011899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]