SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011942 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000011942
Domain Number - Region: 434-513
Classification Level Classification E-value
Superfamily TPR-like 0.0616
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011942   Gene: ENSPANG00000014290   Transcript: ENSPANT00000011969
Sequence length 1134
Comment pep:known_by_projection chromosome:PapAnu2.0:5:172780045:172837147:1 gene:ENSPANG00000014290 transcript:ENSPANT00000011969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPTQWDLPVELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANRRADRVPISFKVLPGDH
EYPKCRPKRTSYEWYIPKGILKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATR
VEIVRQSLQGRNTKVAVVLIQKKTPLPPGEDVIASERAAALCNACELSGKSLFVLPHTDH
LVGYIISRLENAFYEHAQTYYYTEIRRVKSHKEFLNKTTHQLLFVRHQFKIAFFSELKQD
TQNALKNYRTAYNLVHELRAHETNILEIKTMAGFINYKICRLCFQHNTPLDAIAQFRKHI
DLCKKKIGSAELSFEHAAWMSKQFQAFGDLFDEAIKLGLTAIQTQNPGFYYQQAAYYAQE
RKQLAKSLCNHEASVMYPNPDPLETQTGVLDFYGQRSWRQGILSFDLSDPEKEKVGVLAI
QLKERNVAHSEIIITLLSNAVAQFKKYKCPRMKSHLMVQMGEEYYYAKDYTKALKLLDYV
MCDYRSEGWWTLLTSILTTALKCSYLMAQLKDYITYSLELLGRASTLKDDQKSRIEKNLI
NVLMNESPDPEPDCDTFAGKTAQKLWADRISLAGSNVFTIGVQDFVPFVQCKAKFHAPSF
HVDVPVEFDIYLKADCPHPIRFSKLCVSFNNQEYNQFCVIEEASKANEVLENPTQGKMCL
VPGKTRKLLFKFVAKTEDVGKKIEITSVDLALGNETGRCVVLNWQGGGGDAASSQEALQA
ARSFKRRPKLPDNEVHWDSIIIQASTMIISRVPNISVHLQHEPPALTNEMYCLVVTVQSH
EKTQIRDVKLTAGLKPGQDANLTQKTHVTLHGTELCDESYPALLTDIPVGDLHPGEQLEK
MLYVRCGTVGSRMFLVYVSYLINTTAEEKEIVCKCHKDETVTIETVFPFDVAVKFVSAKF
EHLERVYADIPFLLMTDLLSASPWALTVVSSELQLAPSMTTVDQLESQVDNVVLQTGESA
SECFCLRCPSLGNVEGGVATGHYIISWKRTSAMENIPVIRTVITLPHVIVENIPLHVNAD
LPSFGRVRESLPVKYHLQNKTDFVQDVEISVEPSDAFMFSGLKQIRLRILPGTEQEMLYN
FYPLMAGYQQLPSLNINLLRFPNFTNQLLRRFIPTSIFVKPQGRLMDDTSIAAA
Download sequence
Identical sequences ENSPANP00000011942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]