SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011950 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011950
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011950   Gene: ENSPANG00000018420   Transcript: ENSPANT00000008249
Sequence length 212
Comment pep:known_by_projection chromosome:PapAnu2.0:2:45221978:45233291:1 gene:ENSPANG00000018420 transcript:ENSPANT00000008249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVREQSERVA
LCNWAELTPEVLKILHSQVAGRLIVHAEELAQMWKVVNLPADLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEISASHV
SRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Download sequence
Identical sequences A0A096NEY5 Q4R6C5
ENSMMUP00000010962 ENSPANP00000011950 ENSMMUP00000010962 9544.ENSMMUP00000010962 NP_001181555.1.72884 NP_001270153.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]