SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011955 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011955
Domain Number 1 Region: 499-679
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.73e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 367-466
Classification Level Classification E-value
Superfamily WWE domain 0.0000000161
Family WWE domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011955
Domain Number - Region: 177-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0012
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 295-329
Classification Level Classification E-value
Superfamily WWE domain 0.0569
Family WWE domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011955   Gene: ENSPANG00000022225   Transcript: ENSPANT00000009496
Sequence length 702
Comment pep:known_by_projection chromosome:PapAnu2.0:3:161801683:161839663:-1 gene:ENSPANG00000022225 transcript:ENSPANT00000009496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAGVVGEVTQVLCAAGGALELPELRRRLRMGLSADALERLLRQRGRFVVAVRAGGAAA
AQERVVLAASPLRLCRAHQGSKPGCVGLCAQLHLCKFMVYGACKFLRAGKNCRNSHSLTT
EHNLSVLRTHGVDHLSYNELCQLLFQNDPWLLPEICQHYNKGDGPHGSCAFQKQCIKLHI
CQYFLQGECKFGKSCKRSHDFSNSENLEKLEKLGMSSDLVSRLPSIYRNAHDIKNKSSAP
SRVPPPFVPQGTSERKDSSGSVSPNTLSQEEGDQICLYHIRKSCSFQDKCHRVHFHLPYR
WQFLDRGKWKDLDKMELIEEAYCNPKIDRILCSESANTFHSDCLNFNAMTYGATQARRLS
TASAVTKPPHFILTTDWIWYWSDEFGSWQEYGRQGTAHPVTTVSSSDVEKAYLAYCTPGS
DGQAATLKFQAGKHNYELDFKAAFIQKNLVYGTTKKVCRRPKYVSPQDVTTLQTCNTKFP
GPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWE
VYQWQKGQMQKQNGGKAVDERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFAR
DAAYSHHYSKSDTQTHTMFLARVLVGEFVRGNASFVRPPAKEGRSNAFYDSCVNSVSDPS
IFVIFEKHQVYPEYLIQYTTSSKPSVTPSILLALGSLFSSRQ
Download sequence
Identical sequences ENSPANP00000011955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]