SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011957 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011957
Domain Number 1 Region: 121-229
Classification Level Classification E-value
Superfamily Second domain of FERM 6.8e-30
Family Second domain of FERM 0.0021
Further Details:      
 
Domain Number 2 Region: 230-383
Classification Level Classification E-value
Superfamily PH domain-like 2e-24
Family Third domain of FERM 0.0068
Further Details:      
 
Domain Number 3 Region: 27-121
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-17
Family First domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011957   Gene: ENSPANG00000016089   Transcript: ENSPANT00000019763
Sequence length 546
Comment pep:known_by_projection chromosome:PapAnu2.0:4:163069840:163098807:-1 gene:ENSPANG00000016089 transcript:ENSPANT00000019763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSPERPAGNRQEPTLGMDAMASEHRDVLVLLPSQEQLRLTVGVKATGRELFQQVCNAV
SIRDTQFFGLCVIRNNEYIFMDLEQKLSKYFSKDWKKEIYEENEKPRAPFVAFLRVQHYV
ENGRVISDHRARHLYYCHLKERVLRSQCAHREEAYFLLAACALQADLGDHREPAHTGRYF
EPHSYFPQWIITKRGIDYILRHMPALHRERQGLNPKEAVLCFIQEACRLEDVPVHFFRLH
KDKKEGHPTVILGLTLRGVHIYQEVDRAPQLLYDLPWPHIGKLAFLGKKLEIQLDGLPAA
QKLVYYTGCTWRSRHLLHLLRASHQLHLRVRPTLRQLRQREEAEEKQRYRESYISDGLEL
DLDSRGSPGSGVSSQHCPHHLSRHSTDSHGSSHTSGIEADSWLRESREMSVDTPLEVQGL
HEKEPSSSLRTSRSHPSICGDSQAIRQEPCAEVRTRGQSTEAVHQIWEMKAGVSEEPHSR
SLEDTRLHQLALHPAPTSPSRTFHCAPDCGLAAPCENRATLPSKRSSNCLTLDLFGEAPP
PQEFVV
Download sequence
Identical sequences A0A096NG90
ENSPANP00000011957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]