SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011990 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011990
Domain Number 1 Region: 1064-1276
Classification Level Classification E-value
Superfamily SET domain 3.14e-71
Family Histone lysine methyltransferases 0.0014
Further Details:      
 
Domain Number 2 Region: 951-1079
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.32e-31
Family PWWP domain 0.00000252
Further Details:      
 
Domain Number 3 Region: 261-421
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.14e-26
Family PWWP domain 0.0052
Further Details:      
 
Domain Number 4 Region: 1298-1367
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000753
Family PHD domain 0.0036
Further Details:      
 
Domain Number 5 Region: 917-968
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000266
Family PHD domain 0.004
Further Details:      
 
Domain Number 6 Region: 698-750
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000731
Family PHD domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011990
Domain Number - Region: 750-806
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00806
Family PHD domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011990   Gene: ENSPANG00000009526   Transcript: ENSPANT00000005472
Sequence length 1438
Comment pep:known_by_projection chromosome:PapAnu2.0:8:36443695:36517274:-1 gene:ENSPANG00000009526 transcript:ENSPANT00000005472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYP
ATTEDLPPLTNGYPSSISVYETQTKYQSYSQYPNGSANGFGAARNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHMKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
DPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKNVASKTEVKKTR
RPRSVLNTQPEQTSAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRSEKPTQSISSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQAAVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLSD
LQVGFGKQVDSPSATADADVSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGE
CCKHFHLECLGLTSLPDSKFVCMECKTGQHPCFSCKVSGKDVKRCSVGACGKFYHEACVR
KFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSMLV
SSYILICSNHSKRSSNSSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRA
ELMKLPMIPSSSASKKKCEKGGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLH
YKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPY
VEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKAN
KVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCF
TKRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNF
YMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTF
NYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTTEEKAKNAKLKQKRRKIKTEPKQM
HEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCE
FCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
Download sequence
Identical sequences A0A096NGC0
ENSPANP00000011990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]