SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012036 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012036
Domain Number 1 Region: 343-603
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.09e-76
Family Eukaryotic proteases 0.00000000764
Further Details:      
 
Domain Number 2 Region: 285-355
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000612
Family Complement control module/SCR domain 0.00000887
Further Details:      
 
Domain Number 3 Region: 219-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000278
Family Complement control module/SCR domain 0.0000754
Further Details:      
 
Domain Number 4 Region: 60-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000222
Family EGF-type module 0.00034
Further Details:      
 
Domain Number 5 Region: 3-59
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000366
Family Spermadhesin, CUB domain 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012036   Gene: ENSPANG00000007060   Transcript: ENSPANT00000024001
Sequence length 605
Comment pep:known_by_projection chromosome:PapAnu2.0:1:13890843:13910792:-1 gene:ENSPANG00000007060 transcript:ENSPANT00000024001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSSGAKVLATLCGHESTDTERAPGNDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAE
DIDECQVAPGEAPACDHHCHNHLGGFYCSCRVGYILHRNKRTCSAICSIRQFSQTSISIH
LPTHPFTHPSLYSSTHPPILLPAHPSIYPFIHPSIFPAIYIPTHPSTYQSYPCTHSSTDP
SIHPPILLPTNPSRLDSDLAAIDLIKTNMPDFLCAAQPCPYPMAPPNGHVSPVQAKYILK
DSFSIFCEPGYELLQGHLPLKSFAAVCQKDGSWDQPMPSCSIVDCGPPDDLPSGRVEYIT
GPEVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGERSPPVCEPVCGLSARTT
GGRIYGGQKAKPGDFPWQVLILGGSTAAGALLYDNWVLTAAHAIYEQKHDASSLDIRLGA
LKRLSPHYTQAWAEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESF
MRTDDIGTASGWGLTQRGLLARNLMYVDIPIVDHQKCTAAYEKPPYSRGSVTANMLCAGL
ESGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIKN
IISNF
Download sequence
Identical sequences ENSPANP00000012036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]