SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012046 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012046
Domain Number 1 Region: 234-372
Classification Level Classification E-value
Superfamily SH2 domain 4.83e-27
Family SH2 domain 0.00045
Further Details:      
 
Domain Number 2 Region: 118-170
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-21
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 200-282
Classification Level Classification E-value
Superfamily SH3-domain 2.4e-20
Family SH3-domain 0.0000285
Further Details:      
 
Domain Number 4 Region: 6-62
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-18
Family SH3-domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012046   Gene: ENSPANG00000024243   Transcript: ENSPANT00000005663
Sequence length 382
Comment pep:known_by_projection chromosome:PapAnu2.0:13:97058023:97209340:1 gene:ENSPANG00000024243 transcript:ENSPANT00000005663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVER
KNSLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSSADRIYDLNIPAFV
KFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPS
FLSLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCK
NARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECA
LNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEH
YKKAPIFTSEHGEKLYLVRALQ
Download sequence
Identical sequences A0A096NGH0 A0A0D9RWX0 A0A2K5N045 A0A2K6D5L9 F7D094 G7PMW0
XP_001109452.2.72884 XP_008006480.1.81039 XP_011753836.1.29376 XP_011753837.1.29376 XP_011753839.1.29376 XP_011753840.1.29376 XP_011753841.1.29376 XP_011753843.1.29376 XP_011753844.1.29376 XP_011812018.1.43180 XP_011812019.1.43180 XP_011840076.1.47321 XP_011910866.1.92194 XP_011910867.1.92194 XP_011910868.1.92194 XP_014968532.1.72884 XP_014968533.1.72884 XP_014968534.1.72884 XP_014968535.1.72884 XP_014968536.1.72884 XP_015288822.1.63531 XP_015288823.1.63531 XP_015288824.1.63531 ENSMMUP00000001857 ENSMMUP00000001857 ENSMMUP00000036193 ENSPANP00000012046 9544.ENSMMUP00000001857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]