SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012073 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012073
Domain Number 1 Region: 5192-5350
Classification Level Classification E-value
Superfamily SET domain 9.03e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 266-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000377
Family PHD domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1429-1489
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000487
Family PHD domain 0.0039
Further Details:      
 
Domain Number 4 Region: 1504-1571
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000117
Family PHD domain 0.026
Further Details:      
 
Domain Number 5 Region: 1383-1437
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000115
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 215-274
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000104
Family PHD domain 0.015
Further Details:      
 
Domain Number 7 Region: 2034-2084
Classification Level Classification E-value
Superfamily HMG-box 0.00000223
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012073   Gene: ENSPANG00000000833   Transcript: ENSPANT00000020140
Sequence length 5350
Comment pep:known_by_projection chromosome:PapAnu2.0:11:44817089:44852010:-1 gene:ENSPANG00000000833 transcript:ENSPANT00000020140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKLPGEDKDSEPAADGPAASEDPSATESDLPNPHVGEVSVPSSGSPSLQEAPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGSPGPNEAVLPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHRAQGGQPVSS
VAEQHTSVCSRFSPPESGDTPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGVQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEDSPASPLP
EALHLSRPPEESPLSPPPEESPLSPPPESSPFSPLEESPFSPLEESPPSPALETPLSPPP
EASPLSAPFEESPLSPPPEELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLF
PPFEESPLSPPPEESPLSPPPEASRLSPPPEDSPMSPPPEESPMSPPPEVSRLSPLPAVS
RLSPPPEESPLSPPPEESPTSPPPEASRLSPPPEDSPTFPPPEDSPTSPPPENSPTSPPP
EDSLMSLPLEESPLSPLPEEPQLCPPSEEPHLSPRPEEPHLSPRPEEPHLSPQPEEPHLS
PQPEEPCLCAVPEEPHLSPQAEGPHLSPQPEELHLSPQTEEPHLSPVPEEPFLSPQPEES
HLSPQSEEPCLSPRPEESHLSPQLEEPPLSPRPEEHPEEPGQCPAPEELPLFPPAGEPSL
SPLLGEPALSEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIITAVAPPAL
SPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPVGP
ASPILMEPLPPQCSPLLQHSLAPQNSPPSQCSPPALPLSVPSPLSPIGKVVGVSDEPELH
EMETEKVPEPECPALEPSATSPLPSPMGDLSCPAPSPAPALDDFSGLGEDTAPLDGIDAP
GSQPEAGQTPGSLASELKGSPVLLDPEELAPVTPMEVYPECKQTAGQGSPCEEQEEPRAP
VAPTPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPA
RDEGSLRLCTDSLPETDDSLLCDAGTAISGGKTEGEKGRRRSSPARSRIKQGRSSSFPGR
RRPRGGAHGGRGRGRARLKSTASSIETLVVADIDSSPSKEEEEEDDDTMQNTVVLFSNTD
KFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCE
VCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEW
QNSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQADEGFD
CISCQPYVVKPVGAPVAPPELVPMKVKEPEPQYFRFEGVWLTETGMALLRNLTMSPLHKR
RQRRGRLGLPGEAGLEGSEPSEALGPDDKKDGDLDTDELLKGEAYAGGVEHMECEIKLEG
PVSPDVEPGKEETEESKKRKRKPYRPGIGGFMVRQRKSHTRTKKGPAAQAEVLSGDGQPD
EVIPADLPAEGTVEQSLAEGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSRKA
LFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPED
GGVKASPVPSDPEKPGTPGEGMLSSDLDRISTEELPKMESKDLQQLFKDVLGSEREQHLG
CGTPGLEGSRTPLQRPFLQGGLPLGNLPSSSPMDSYPGLCQSPFLDSRERGGFFSPEPGE
PDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINF
PNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINKQT
KVGDVARKTDRPALHLRIPPQPGALGSPPPAAAPTIFIGSPATPAGLSTSADGFLKPPAG
SVPGPDSPGELFLKLPPQVPAQVPSQDPFGLTPAYPLEPRFPTAPPTYPPYPSPTGAPAQ
PPMLGASSRPGTGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGKA
SEPLLSPPPFGESRKALEVKKEELGASSPSYGPPNLGFVDSPSSGPHLGGLELKTPDVFK
APLTPRASQVEPQSPGLGLRPQDPPPAQALAPSPPSHPDIFRTGSYPDPYAQPPLTPRPQ
PPPPESCCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPD
PYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGSLAHTSLGAGGFPAALPSGPAGELHT
KVPSGQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPPPHGINSHFGP
GPTLGKPQSTNYAVATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPAPDGSLPYL
SHGASQRSGITSPVEKREDPGAGMGSSLATPELPGTQDPGMSGLSQTELEKQRQRQRLRE
LLIRQQIQRNTLRQEKETAAAAAGAVGPPGSWGAEPSSPAFEQLSRGQTAFAGTQDKSNL
VGLPPGKLSGPILGQGSFPGDDRLSRPPPPATPSSMDVNSRQLVGGSQAFYQRAPYPGSL
PSSMRFAMSARFPSTPVPELGRQALGSPLAGIPTRLPGPGEPVPGPAGPAQFIELRHNVQ
KGLGPGGTPFPGQGPPQRPRFYPVSEDPHRLAPEGLRGLAVSGLPPQKPSAPPAPELNNS
LHPTPHTKGPTLPTGLELVSRPASSTELGRPTPLALEAGKLPCEDPELDDDFDAHKALED
DEELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDI
FNEHLRLVESANEKAEREALLRGVEPGPLGPEERPPPAADASEPRLASVLPEVKPKVEEG
GRHPSPCQFTIATPKVEPAPAANSLGLGLKPGQSVMGSRDTRMGTGPFSSSGHTAEKGSF
GATGGPPAHLLTPSPLSGPGGSSLLEKFELESGALTLPGGPVASGDELDKMESSLVASEL
PLLIEDLLEHEKKELQKKQQLSLLSAPGPAQAMSLPHEGSSPSLAGSQQQLSLGLGGARQ
PGLPQPLMPTQPPAHALQQRVAPSMAMVSNQGHMLSGQHGGQAGLVPQQSSQPVLSQKPM
GTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVALKGIKKVMAQG
SIGVAPGMNRQQVSLLAQRLSGGPGSDLQNHVAPGSGQERSAGDPSQPRPNPPTFAQGVI
NEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAE
KLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRTVLALSPSQSPRLLTKLPGQLLPGHG
LQPPQGPPGGQAGGLRLPPGGMALPGQPGGPFLNTALAQQQQQQHSGGAGSLAGPSGGFF
PGNLALRSLGPDSRLLQERQLQLQQQRMQLAQKCPGVQTNQALGPKPQGLLPPSSHQGLL
VQQLSPQPPQGPQGMLGPAQVAVLQQQHPGALGPQGPHRQVLMTQSRVLSSPQLAQQGQG
LMGHRLGSMAGLSHLQQSLMSHSGQPKLSTQPMGSMGLLNQSRTLLSPQQQQQQQVALGP
GMPAKPLQHFSSPGALGPTLLLTGKEQNTVDPAVSSEVTEGPSTHQGGSLAIGTTPESMA
TEPGEVKPSLSGDSQLLLIQPQPQPQSSSLQLQPPLRLPGQQQQQVSLLHTAGGGSHGQL
GSGSSSEASSMPHLLAQPSVSLGEQPGPMTQNLLGPQQPMLERPMQNNTGPQPPKPGPVL
QSGQGLPGVGIMPTVGQLRAQLQGVLAKNPQLRHLSLRQTPPYQEPGTQTSPLQGLLGCQ
PQLGGFPGSQTGPHQELGAGPRPQGPPRLPAPPGALSTGPVLGPVHPTPPPSSPQEPKRP
SQLPSPSSQLPTEAQLPPAHPGTPKPQGPSLELPPGRVSPAAAQLADTLFGKGMGPWDPP
DNLAETQKPEQSSLVPGHLDQVNGQVVPEAPQLSIKQEPREEPCALGAQSVKREANGEPI
GAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGRGSEGLRAEINGHIDSKLAGLEQ
KLQGTPSNKEDAAARKPLTPKPKRVQKASDRLVSSRKKLRKEDGVRASEALLKQLKQELS
LLPLTEPAITANFSLFAPFGSGCPVNGQSQLRGAFGSGALPTGPDYYSQLLTKNNLSNPP
TPPSSLVQQKMVNGVTPSEELGEHPKDAASARDTEGALRDTSEVKSLDLLAALPTPPHNQ
TEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPHLGSGRWEQEDRALSPVIPLIPRA
SIPVFPDTKPYGALDLEVPGKLPATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELL
SMKIPNSYEVLFPEGPARAGTEPKKGEAEGPGGKEKGLGGKSQDTGPDWLKQFDAVLPGY
TLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPAS
PPTEPLVELPAEPLAEPPVPSPLPLASSPESARPKPRARPPEEGEDSRPPRLKKWKGVRW
KRLRLLLTIQKGSGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPA
RLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRM
RCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIAS
IIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCC
YRCSIGENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEY
LKGEELFGLTVHAVLRIAESLPGVENCQNYLFRYGRHPLMELPLMINPTGCARSEPKILT
HYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQ
GLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTG
GPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHC
GAWNCRKWMN
Download sequence
Identical sequences ENSPANP00000012073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]