SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012081 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012081
Domain Number 1 Region: 364-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number 2 Region: 93-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number 3 Region: 451-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number 4 Region: 285-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 5 Region: 192-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.035
Further Details:      
 
Domain Number 6 Region: 412-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012081
Domain Number - Region: 228-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000131
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number - Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number - Region: 140-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 59-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012081   Gene: ENSPANG00000013396   Transcript: ENSPANT00000026929
Sequence length 494
Comment pep:known_by_projection chromosome:PapAnu2.0:17:78766218:79015501:1 gene:ENSPANG00000013396 transcript:ENSPANT00000026929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGA
ALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQG
WYGDACQYPTHCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCEC
DDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICS
NRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
CKAGWYGKKCEHPQSCTLSPEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKT
CECDDRRCEDLDGVVCGGHGTCSCGRCICERGWFGKLCQHPRKCNMTEEQSKNLCESADG
ILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKYDGLICTGNGICSCGNCECWDGW
NGNACEIWLGSEYP
Download sequence
Identical sequences A0A096NGK2
ENSPANP00000012081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]