SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012149 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012149
Domain Number 1 Region: 530-562,637-711
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012149   Gene: ENSPANG00000012991   Transcript: ENSPANT00000006210
Sequence length 746
Comment pep:known_by_projection chromosome:PapAnu2.0:3:125529678:125595294:-1 gene:ENSPANG00000012991 transcript:ENSPANT00000006210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPV
IMYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQEKELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLAS
LMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVS
SLFLGLDYGLITAVIIALLTVIYRTQRWSYKELGKLPETDVYIDIDAYEEVKEIPGIKIF
QINAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAE
VDGEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNIHTVILDFTQVNFIDSVGVK
TLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQRREA
LAEQEALAAPPQEDLEPNATPATPEA
Download sequence
Identical sequences ENSPANP00000012149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]