SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012166 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012166
Domain Number 1 Region: 325-445
Classification Level Classification E-value
Superfamily SET domain 2.22e-27
Family Histone lysine methyltransferases 0.048
Further Details:      
 
Domain Number 2 Region: 91-155
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-16
Family PHD domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012166   Gene: ENSPANG00000005214   Transcript: ENSPANT00000007480
Sequence length 1820
Comment pep:known_by_projection chromosome:PapAnu2.0:3:127167177:127242094:1 gene:ENSPANG00000005214 transcript:ENSPANT00000007480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLPYADHNYGARPPPTPPASP
PPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTRCICGFTHDDGYMICCDKC
SVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRKRENMSDGDTSATESGDEV
PVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISKCKKAFREGSRKSSRVKGS
APEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREAQRIALRLGNGNDKKEMNK
SDLNTNSLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRP
YPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHEIQDGTIHLYIYSIQSIPK
GTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESMENISSGYETRRTQNQNITLD
CEGTTNKMKSPETKQRKLSPLRLSVSNNQEPDFIDDIEEKTPVSNEVEMESEEQIAERKR
KMTREERKMEAILQAFARLEKREKRREQALERISTAKTEVKTECKDTQIVSDAEVIQEQA
KEENASKPTPAKVNRTKQRKSFSRSRTHIGQQRRRHRTVSMCSDIQPSSPDIEVTSQQND
IENTVLTIEPETETALAEIITETEVPALNKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDG
LSERPLRITTDPEVLATQLNSLPGLTYSPHVYSTPKHYIRFTSPFLSEKRRRKEPTENIS
GSCKKRWLKQALEEENSAILHRFNSPCQERSRSPAVNGENKSPLLLNDSCSLSDLTTPLK
KRRFYQLLDSVYSETSTPTPSPYATPTHTDITPMDPSFATPPRIKSDDETCRNGYKPIYS
PVTPVTPGTPGNTMHFENISSPESSPEIKRRTYSQEGYDRSSTMLTLGPFRNSNLTELGL
QEIKTIGYMSPRSRTEVNRQCPGEKEPMSDLQLGLDAVEPTALHKTLEAPAHDRAEPNSQ
LDSTHSGRGTIYSSWVKSPDRTGVNFSVNSNLRDLTPSHQLEVGGGFRISESKCLMQDDT
RGMFMETTVFCTSEDGLVSGFGRTVNDNLIDGSCTPQNPPQKKKVSLLEYRKRQREARKS
GSKTENFPLISVSPHASGSLSNNGDGCASSNENGEQVEHTASLPLPTPATVYNATSEETS
NNCPVKDATASEKNEPEVQWTASTSVEQVRERSYQRALLLSDHRKDKDSGGESPCVSCSP
SHVQSSPSSHSNHIPQLQAKGPVPSFSELMEDPDPENPEPTTTSECPSPDTSQNTCKSPS
KMSKPGSPGSVIPAQAHGKIFTKPDPQWDSTVTASEAENGVHLKTELQQKQLSNNSQALS
KNHPPQTHVRNSSEQLSQKLPSAPTKLHCPPSPHLENPPKSSTPHTPVQHGYLSPKPPSQ
QLGSPYRPHHSQSPQVGTPQREPQRNFYPAAQNLQANTQQATSGTLFTQTPSGQSAATYS
QFNQQSLNSTAPPPPPPPPPSSSYYQNQQPSANFQNYNQLKGSLSQQTVFTSGPNQALPG
TTSQQTVPGHHVTPGHFLPSQNPTIHHQTAAAVVPPPPPPPPAPGPHLVQQPNSHQQHSV
AHVVGPVHAVTPGSHIHSQTAGHHSPGPAPHHHPPPHPSTGLQGLQAQHQHVVNSAPPPP
PPPPPSSVLASGHHTTSAQALHHPPHQGPPLFPSSAHPAVPPYPSQATHHTTLGPGPQHQ
PSGTGPHCPLPVTGPHLQPQGPNSIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIP
IHRAQVPPTFQNNYHGSGWH
Download sequence
Identical sequences ENSPANP00000012166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]