SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012187 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012187
Domain Number 1 Region: 270-413
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-33
Family cAMP-binding domain 0.000000205
Further Details:      
 
Domain Number 2 Region: 136-267
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-32
Family cAMP-binding domain 0.000000179
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000719
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012187   Gene: ENSPANG00000019819   Transcript: ENSPANT00000005026
Sequence length 419
Comment pep:known_by_projection chromosome:PapAnu2.0:3:129215893:129328081:1 gene:ENSPANG00000019819 transcript:ENSPANT00000005026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERGTARFGHEGRTWDAG
ASAAAAGGGTPSKGVNFAEEPMHSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEA
YNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGE
HVIDQGDDGDNFYVIDRGTYDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITAT
SPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYND
GEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNK
PRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Download sequence
Identical sequences ENSPANP00000012187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]