SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012192 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012192
Domain Number 1 Region: 216-487
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-79
Family Protein kinases, catalytic subunit 0.0000000928
Further Details:      
 
Domain Number 2 Region: 111-254
Classification Level Classification E-value
Superfamily SH2 domain 1.99e-40
Family SH2 domain 0.0000297
Further Details:      
 
Domain Number 3 Region: 37-120
Classification Level Classification E-value
Superfamily SH3-domain 4.81e-22
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012192   Gene: ENSPANG00000015735   Transcript: ENSPANT00000004698
Sequence length 504
Comment pep:known_by_projection chromosome:PapAnu2.0:4:146424208:146538679:1 gene:ENSPANG00000015735 transcript:ENSPANT00000004698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGAHCSPQSQRHGHYFVALFDYQARTAED
LSFRAGDKLQVLDTSHEGWWFARHLEKRRGGSSQQLQGYIPSNYVAEDRSLQAEPWFFGA
IRRSDAEKQLLYSENKTGAFLIRESESQKGEFSLSVLDGGVVKHYRIRRLDEGGFFLTRR
RTFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRL
GSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPRDFLREAQIMKNLRHPKLIQLYAVCTLED
PIYIITELMRHGSLQEYLQSDAGSKIHLTQQVDIAAQVASGMAYLESRNYIHRDLAARNV
LVGEHNIYKVADFGLARVFKVDNEDIYESKHEIKLPVKWTAPEAIRTNKFSIKSDVWSFG
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEKERPTFE
TLHWKLEDYFETDSSYSDANNFIR
Download sequence
Identical sequences ENSPANP00000012192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]