SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012200 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012200
Domain Number 1 Region: 42-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 155-346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000304
Family Pentraxin (pentaxin) 0.0047
Further Details:      
 
Domain Number 3 Region: 868-1148
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000256
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012200   Gene: ENSPANG00000011062   Transcript: ENSPANT00000016651
Sequence length 1229
Comment pep:known_by_projection chromosome:PapAnu2.0:4:119918003:119995562:-1 gene:ENSPANG00000011062 transcript:ENSPANT00000016651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYRSNLTFLYSWAWFPSFKLLILFSLWVLIFPFVPAVWGCANCRVVLSNPSGTFTSPCYP
NDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGL
SFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSVSIP
ELSAFTLCFEATKVGHEDNDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALP
VKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQN
EIVSLKGDIYNFRLWNFTMNAKILSNLSCNMKGNVVDWQNDFWNIPNLALKAESNLSCDQ
GSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISV
VIQNILRHPEVKVQSKVAEWLNSTFENWNYTVYVINISFHLSGGEDKIKVKRSIENEPRL
VLWALLVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLHTVNVRQIGYCLAVEEPKGYYW
PSIQPSEYVLPCPDKPDFSASRICYYNATNRSLTYWGPPDISSCSTFVLEANEVANQILD
LTADGQNLTSANITNIVEQVKRIVNKEENIDITLGSTLMNIFSNILSSSDSDLLESSSEA
LKTIDELAFKIDLNSTSHVNITTRNLALGVSSLLPGTNAISNFSIGLPSNNESYFQMDFE
SGQVDPLASVILPPNLLENLSQEDSVLVRRAQFTFFNKTGLFQKDVGPQRKTLVSYVMAC
SIGNITIQNLKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASE
TVCLCNHFTHFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKL
RRDYPSKILMNLSAALLFLNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEA
IHMYIALVKVFNTYIRRYILKFCIIGWGLPALVVSIVLASRNKNEVYGKESYGKEKGDEF
CWIQDPVIFYVTCAGYFGVMFFLNIAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVS
LTFLLGMTWGFAFFAWGPLNIPFTYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCG
RFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTD
NVSYEHSFNKNGSFRQCFHGQVLVKTGPC
Download sequence
Identical sequences ENSPANP00000012200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]