SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012240 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012240
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.12e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00000589
Further Details:      
 
Domain Number 2 Region: 78-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.09e-22
Family Cold shock DNA-binding domain-like 0.00000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012240   Gene: ENSPANG00000025888   Transcript: ENSPANT00000022233
Sequence length 172
Comment pep:known_by_projection chromosome:PapAnu2.0:14:10963261:10972008:-1 gene:ENSPANG00000025888 transcript:ENSPANT00000022233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
Download sequence
Identical sequences A0A096NGZ4 A0A0D9R314 A0A0P6J5D6 A0A1A6FYY4 A0A1D5R0T0 A0A286Y3A0 A0A2F0B923 A0A2J8TY01 A0A2K5F405 A0A2K5KDB7 A0A2K5M8A3 A0A2K5U485 A0A2K5YPF9 A0A2K6DLU1 A0A2K6JS89 A0A2K6S6K1 F6RG40 F7ID17 G1LIJ3 G1SXB1 G3R7V2 H2Q3W9 I3LJZ9 M3YQF5 P62487 P62488 P62489 Q5E9B8 U6CUD6
ENSECAP00000018880 ENSCJAP00000034715 ENSPTRP00000006506 ENSTTRP00000002322 NP_001015633.1.59421 NP_001015633.1.76553 NP_001253453.1.72884 NP_002687.1.87134 NP_002687.1.92137 NP_080605.1.92730 NP_446400.1.100692 NP_446400.1.4139 XP_001495008.2.31192 XP_002721043.1.1745 XP_002755481.1.60252 XP_002925403.1.58354 XP_003828553.1.60992 XP_003993576.1.62641 XP_004051425.2.27298 XP_004264277.1.21590 XP_004413835.1.74151 XP_004449284.1.11602 XP_004646763.1.9945 XP_004656499.1.11716 XP_004682766.1.23501 XP_004874457.1.39548 XP_005002916.1.53824 XP_005351962.1.66349 XP_005414824.2.28644 XP_005577614.1.63531 XP_005699849.1.57651 XP_005966859.1.78601 XP_006064586.1.26621 XP_006181841.1.101512 XP_006214901.1.17985 XP_006231035.1.100692 XP_006730414.1.47382 XP_006995242.1.50099 XP_007110029.1.24612 XP_007993409.1.81039 XP_008158952.1.99482 XP_008530419.1.77740 XP_008530420.1.77740 XP_008571722.1.73410 XP_008835730.1.79516 XP_010334083.1.74449 XP_010334089.1.74449 XP_010383169.1.97406 XP_010631277.1.5607 XP_010852285.1.44457 XP_011366968.1.92234 XP_011718790.1.29376 XP_011798049.1.43180 XP_011848789.1.47321 XP_011897423.1.92194 XP_012309870.1.9421 XP_012785690.1.84141 XP_012900159.1.14098 XP_013849657.1.46622 XP_014689854.1.49734 XP_015983309.1.101085 XP_016071831.1.3490 XP_016776576.1.37143 XP_016803407.1.37143 XP_017510043.1.32401 XP_017510044.1.32401 XP_017733833.1.44346 XP_019270265.1.44245 XP_019810834.1.53367 XP_020755226.1.74333 XP_021507534.1.76796 XP_021540615.1.83697 XP_533260.1.84170 2c35_B 2c35_D 2c35_F 2c35_H 5flm_G 5iy6_G 5iy7_G 5iy8_G 5iy9_G 5iya_G 5iyb_G 5iyc_G 5iyd_G 5oik_G 6exv_G 6gmh_G 6gml_G gi|4505947|ref|NP_002687.1| ENSP00000301788 ENSPANP00000012240 ENSCPOP00000001040 ENSSSCP00000024413 ENSCPOP00000001040 2c35B ENSDNOP00000029067 ENSMPUP00000013564 ENSBTAP00000012481 ENSECAP00000018880 ENSMMUP00000018873 10090.ENSMUSP00000093980 10116.ENSRNOP00000026313 10141.ENSCPOP00000001040 9544.ENSMMUP00000018873 9598.ENSPTRP00000006506 9606.ENSP00000301788 9796.ENSECAP00000018880 9913.ENSBTAP00000012481 9986.ENSOCUP00000008180 ENSMMUP00000018873 ENSRNOP00000026313 ENSGGOP00000011449 ENSMUSP00000093980 ENSRNOP00000026313 ENSMPUP00000013564 ENSOCUP00000008180 ENSMUSP00000093980 ENSP00000301788 ENSMUSP00000093980 ENSCJAP00000034715 ENSPTRP00000006506 ENSGGOP00000011449 ENSOCUP00000008180 ENSAMEP00000006746 ENSP00000301788 ENSAMEP00000006746 ENSSSCP00000024413 ENSBTAP00000012481 ENSTTRP00000002322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]