SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012268 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012268
Domain Number 1 Region: 219-284
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000466
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012268   Gene: ENSPANG00000014640   Transcript: ENSPANT00000016196
Sequence length 470
Comment pep:known_by_projection chromosome:PapAnu2.0:1:18843299:18883801:-1 gene:ENSPANG00000014640 transcript:ENSPANT00000016196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNRNTQMYTEEEKTASSFLPSTPGPTKTKGGGEAVETQPAPGPLPPPEVRDIGERREPD
RVQQQPQKPVVAAGTQNLRKFRQGFMKCLLEVEKVEASHRRALKARSLTAQKSPRTLTPV
PTSSPSLPQTPASAPASGPSWARLSAPGPEPAPVGAPVPTSTPCPVLLCPALDLGWRRME
LSHHSSERTLSYAKARQEPEEQSLQKLYQNREKSEEQLTLKQEEAFRSYFEIFNGPGEVD
AQSLKNILLLMGFSVTPAQVEDALMSADVNGDGHVDFKDFLAVMTDTRRFFCSVEQNALT
DMAPHNPHTLLFEILSLLVEMLALPEAVLEEITNYYQKKLKAGTCKAQEMEAAIGRLRLQ
KKLPYNPQQEESSEVPERKVLSILSRLKQQNYAPNLQSPYAQVPCIPLCPRMDKKMVRRK
PTNHYVQDQCTTPGLDPDIRSPFFQSRSQGNREHNSDSRKWPSSVPSRTH
Download sequence
Identical sequences A0A096NH21
ENSPANP00000012268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]