SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012278 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012278
Domain Number 1 Region: 915-1184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.1e-71
Family Tandem AAA-ATPase domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 655-913
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.92e-55
Family Tandem AAA-ATPase domain 0.000049
Further Details:      
 
Domain Number 3 Region: 413-463,491-534
Classification Level Classification E-value
Superfamily Chromo domain-like 2.33e-17
Family Chromo domain 0.021
Further Details:      
 
Domain Number 4 Region: 554-625
Classification Level Classification E-value
Superfamily Chromo domain-like 2.95e-17
Family Chromo domain 0.0044
Further Details:      
 
Domain Number 5 Region: 298-371
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.86e-17
Family PHD domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012278
Domain Number - Region: 140-179
Classification Level Classification E-value
Superfamily HMG-box 0.000405
Family HMG-box 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012278   Gene: ENSPANG00000006765   Transcript: ENSPANT00000018630
Sequence length 1941
Comment pep:known_by_projection chromosome:PapAnu2.0:1:8947367:9024050:-1 gene:ENSPANG00000006765 transcript:ENSPANT00000018630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPLGTEEELPRLFAEEMENEDEMSEEEDGGLEGFDDFFPVEPVSLPKKKKPKKLKENK
CKGKRKKKEGSNDELSENEEDLEEKSESEGSDYSPNKKDEDEDDNDDGCLKEPKSSGQLM
AEWGLDDVDYLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSAN
NPFKGSSAAAAAAAVAAAVETVTISPPLAVSPPQVPQPVLIRKAKTKEGKGPGVRKKIKG
SKDGKKKGKGKKMAGLKFRFGGISNKRKKGSSSEEDEREESDFDSASIHSASVRSECSAA
LGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAP
EGKWSCPHCEKEGIQWEPKDDDDEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSY
HLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFMVGLPGPDVEPSLP
PPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGS
GDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLP
YDQCTWEIDDIDIPYYDNLKQAYWGHRELMLGEDTRLPKRLLKKGKKLRDDKQEKPPDTP
IVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVF
LYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFE
DNAIRSGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSK
FFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIK
KLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGN
QVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRD
EGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLL
STRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERI
TQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGMMSQGQRPVTP
IPDVQSSKGGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTEL
QNMNEYLSSFKVAQYVVREEDGVEEVEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARN
LGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRR
QLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRG
KSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFE
HVNGKYSTPDLIPEGPEGKKPGEVISSDPNTPVPASPAHLPPAPLSLPDKMEAQLGYMDE
KDPGMQKPKKPLEVQALPAALDRVEGEDKHESPASKERAREERPEETEKAPPSPEQLPRE
EVLPEKEKVLDKLELSLIHSRGDGSELRPDDTKAEEKEPIETQQNGDKEEDDEGKKEDKK
GKFKFMFNIADGGFTELHTLWQNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQD
IQNDPRYMILNEPFKSEIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDP
NHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVPPTTVLNQLEELLSDMKA
DVTRLPSMLSRIPPVAARLQMSERSILSRLTNRAGDPTIQQGAFGSSQMYSNNFGPNFRG
PGPGGIVNYNQMPLGPYVTGR
Download sequence
Identical sequences ENSPANP00000012278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]