SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012305 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012305
Domain Number 1 Region: 279-412
Classification Level Classification E-value
Superfamily TPR-like 0.0000759
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012305   Gene: ENSPANG00000021601   Transcript: ENSPANT00000007937
Sequence length 704
Comment pep:known_by_projection chromosome:PapAnu2.0:20:71586516:71623538:1 gene:ENSPANG00000021601 transcript:ENSPANT00000007937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRALRRLRGEQRGQEPIGPSALQFDLRDDDDAEEEGPKRELGVRRPGGAGKEGVRVNN
RFELINIDDLEDDPVVNGERSGCALTDTAARGNKGRARRGNTESKTDGDVAGTAPPEQSN
ASGKLRKKKKKQKNKKSSTGEASENVLEDIDRILERIEDSTGLNRPGPAPLSSRKHILYV
EHRHLNPDTELKRYFGARAVLGEQRPRQRQRVYPKCTWLTTPKSTWPRYSKPAGTPEHCR
QGLHGHVFLQDSGLGQGHQEGLSMRLLESRKGLSFFAFEHSEEYQQAQHKFLVAVESMEP
NNIVVLLQTSPYHVDSLLQLSDACRFQEDQEMARDLVERALYSMECAFHPLFSLTSGACR
LDYRRPENRSFYLALYKQMSFLEKRGCPRTALEYCKLILSLEPDEDPLCMLLLIDHLALR
ARNYEYLIRLFQEWEAHRNLSQLPNFAFSVPLAYFLLSQQTDLPEHERSSAREKASLLIQ
QALTMFPGVLLPLLESCSVRPDITVSSHSFFGPNAEISQPPALSQLVNLYLGRSHFLWKE
PATMSWLEENVRAVLQTVDAGDPAVEACENRRKVLYQRAPRNIHRHVILSEIKEAVAALP
PDVTTQSVMGFDPLPPSDTIYSYVRPERLSPVSHGNTIALFFRSLLPNYTVEGERPEEGV
AGGLNRNQGLNRLMLAVRDMMANFHLNDLEAPHEDDADGEGEWD
Download sequence
Identical sequences ENSPANP00000012305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]