SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012327 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012327
Domain Number 1 Region: 384-498
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-24
Family PDI-like 0.0011
Further Details:      
 
Domain Number 2 Region: 253-385
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.34e-20
Family ERP29 N domain-like 0.054
Further Details:      
 
Domain Number 3 Region: 43-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.16e-17
Family PDI-like 0.0069
Further Details:      
 
Domain Number 4 Region: 158-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000521
Family PDI-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012327   Gene: ENSPANG00000004809   Transcript: ENSPANT00000008062
Sequence length 585
Comment pep:known_by_projection chromosome:PapAnu2.0:20:18563547:18603112:-1 gene:ENSPANG00000004809 transcript:ENSPANT00000008062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLWMPLLLVAARISAVHSSPEVNAGVSSIHITKPVHILEERNLLVLTPAGLTQMLNQT
RFLMVLFHSPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITVEKELQQEFGITKAPQ
LKLFFEGNRSEPISCKGVVESTALVVWLRRQISQKAFLFNSSEQVAEFVTSRPLVIVGFF
QDLEEEVAELFYDVIKDFPELTFGVITIGNAIGRFHVTLDSILVFKKGKIVNRQELINDS
TNKQELNRVIKQHLTDFVIEYNAENKDLIYELYIMSHMLLFVSKSSESFGIIIQHYKLAS
KEFQNKILFILVNADEPRNRRVIEYFRVTEVDIPSVQILNLSSDARYKMPSDDITYENLK
KFGRSFLSKNAKKHQSSEEIPKHWDQGLVKQLVGKNFNIVVFDKEKDVFVMFYAPWSKKC
KMLFPLLEELGRKYQNHSTIIIAKIDITANDIQLMYLDRYPFFRLFPTDSQQAVLYKGEH
TLKGFSDFLESHIKTRIEDEDEDELLSVEQNEVIKEEVPAKEKEVPMTKKELPEQQSPEL
KNVTKHVSKLEESAGKKKTSEEVVVVAKPKGPPTQKKKPKVKEEL
Download sequence
Identical sequences A0A096NH79
ENSPANP00000012327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]