SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012336 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012336
Domain Number 1 Region: 263-432,598-817,855-886
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.86e-122
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000471
Further Details:      
 
Domain Number 2 Region: 447-599
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.96e-54
Family ValRS/IleRS/LeuRS editing domain 0.0000337
Further Details:      
 
Domain Number 3 Region: 888-1144
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 6.92e-51
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00011
Further Details:      
 
Domain Number 4 Region: 87-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012336   Gene: ENSPANG00000014565   Transcript: ENSPANT00000016545
Sequence length 1202
Comment pep:known_by_projection chromosome:PapAnu2.0:4:31117086:31136128:-1 gene:ENSPANG00000014565 transcript:ENSPANT00000016545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILYVSPHPDAFPSLRALIAARYGEAGEGPGWGGAHPRICLQPPPTSRTPFPPPRLPAL
EQGPGGLWVWGATAVSQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALG
LRSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPA
RRIWNNVTRWFVTCVRQPEFRAVLGEVVLYSGARPLSHQPGPETPALPKTAAQLKKEAKK
REKLEKFQQKQKIQQQQPPAGERPNVSAANPRGVFMMCIPPPNVTGSLHLGHALTNAIQD
SLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLWREQGLSRHQLGREAFLQEVWKWKEE
KGDRIYHQLKKLGSSLDWDRACFTMDPKLSAAVTEAFVRLHEEGVIYRSTRLVNWSCTLN
SAISDIEVDKKELTGRTLLSVPGYKEKVEFGVLVSFAYKVQGSDSDEEVVVATTRIETML
GDVAVAVHPKDTRYQHLKGKNVIHPFLSRSLPIVFDEFVDMDFGTGAVKITPAHDQNDYE
VGQRHGLEAISIMDSRGALINVPPPFLGLPRFEARKAVLVALKDRGLFRGVEDNPMVVPL
CNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWHAWMDNIREWCIS
RQLWWGHRIPAYFVTVSDPAVPPGEDPDGRYWVSGRNEAEAREKAAKEFGVSPDKISLQQ
DEDVLDTWFSSGLFPLSIFGWPNQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKLTG
RLPFREVYLHAIVRDAHGRKMSKSLGNVIDPLDVIYGVSLQGLHDQLLNSNLDPSEVEKA
KEGQKADFPAGIPECGTDALRFGLCAYTSQGRDINLDVNRILGYRHFCNKLWNATKFALR
GLGKGFVPSPTSQPGGHESLVDRWIRSRLTEAVRLSNQGFQAYDFPAATTAQYSFWLYEL
CDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMPQA
PPSLCVTPYPEPSECSWKDPEAEAALELALSITRAVRSLRADYNLTRIRPDCFLEVADEA
TGALASAVSGYVQALSSAGVVAVLALGAPAPQGCAVALASDRCSIHLQLQGLVDPARELG
KLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQK
ML
Download sequence
Identical sequences ENSPANP00000012336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]