SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012337 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012337
Domain Number 1 Region: 228-380
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.01e-26
Family DnaQ-like 3'-5' exonuclease 0.00094
Further Details:      
 
Domain Number 2 Region: 505-663
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.72e-16
Family Canonical RBD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012337   Gene: ENSPANG00000006898   Transcript: ENSPANT00000023625
Sequence length 772
Comment pep:novel chromosome:PapAnu2.0:20:18887528:18929695:1 gene:ENSPANG00000006898 transcript:ENSPANT00000023625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPERAGTERHPRKVRKRRQAPNKLVGAAEAMKASWDLEESQPEAKKARLSTILFTDNCE
VTHDQLCELLKYAVLGKSNVPKPSWCQLFHQNHLNNVVVFVLQGMSQLHFYRFYLEFGCL
RKAFRHKFRLPPPSSDFLADIVGLQTKQRAGDLPKTMEGPLPSNAKATINLQNDPIIQKY
GSKKVGLTRCLLTKEEMRTFHFPLQGFPECENFLLTKCNGSIADNSPLFGLDCEMCLTSK
GRELTRISLVAEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL
LPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGRRFKLKFLAKAILGKDIQCPDR
LGHDATEDARIILELAQYFLKYGPKKIAELNLEALANHQEIQAAGQEPRNTTEILQHPNT
SVLECLDSVGQKLLFLTREIDAGELASSRNCQTIKCLSNKEVLEQARVEIPLFPFSIVQF
SFKAFSPILTEEMNKRMRIKWTEISTVYAGPFSKNCNLRALKRLFKSFGPVQSMTFVLET
RQPHLCIQYEVLEAAQLAIESLDGILVDGTCIKVQRPVTELTLDCETLVNELEGDSENQG
SIYLFGVSETFKEQLLQEPRLFLGLEAVILPKDLKNGKQKKYCFLKFKSFGSAQRALNIL
TGKDWKLKGRHALTPRHLHAWLRGLPSESRRPAGLRVVPPPFEQEALQTLKLDHPKIAAW
RWGRKIGKLYNSLCPGTLCLILLPGTKSTHGSLSGLGLMGIKEEEESTISGL
Download sequence
Identical sequences ENSPANP00000012337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]