SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012346 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012346
Domain Number 1 Region: 458-745
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-53
Family Eukaryotic proteases 0.0000342
Further Details:      
 
Domain Number 2 Region: 188-454
Classification Level Classification E-value
Superfamily vWA-like 2.64e-52
Family Integrin A (or I) domain 0.0000141
Further Details:      
 
Domain Number 3 Region: 84-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000806
Family Complement control module/SCR domain 0.00035
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.00049
Further Details:      
 
Domain Number 5 Region: 24-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000153
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012346   Gene: ENSPANG00000021507   Transcript: ENSPANT00000012285
Sequence length 752
Comment pep:known_by_projection chromosome:PapAnu2.0:4:31282444:31301520:1 gene:ENSPANG00000021507 transcript:ENSPANT00000012285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMVLFCLLFLYPGPADSATSCPQNVNISGGTFTLSHGWAPGSLLIYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLTKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGSRFGHGDKVRYRCSSN
LVLTGSAERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQRTKES
LGRKIQIQRSGHLNLYLLLDSSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
EPKVLMSVLNVNSRDITEVISSLENAKYKDHENGTGTNTYAALNSVYLMMNNQMQLLGMK
TMAWQEIRHAIILLTDGKSNMGGSPKTAVDQIREILNINQKRNDYLDIYAIGVGKLDVDW
RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVI
SPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTC
RDHEHELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVT
DQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRS
KVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
Download sequence
Identical sequences A0A096NH98 A0A2K5KV12
XP_011910177.1.92194 ENSPANP00000012346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]