SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012347 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012347
Domain Number 1 Region: 473-758
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-61
Family Eukaryotic proteases 0.000000000121
Further Details:      
 
Domain Number 2 Region: 203-472
Classification Level Classification E-value
Superfamily vWA-like 1.13e-58
Family Integrin A (or I) domain 0.0000000022
Further Details:      
 
Domain Number 3 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0000299
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000612
Family Complement control module/SCR domain 0.0000253
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000306
Family Complement control module/SCR domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012347   Gene: ENSPANG00000022696   Transcript: ENSPANT00000012286
Sequence length 764
Comment pep:novel chromosome:PapAnu2.0:4:31302379:31308204:1 gene:ENSPANG00000022696 transcript:ENSPANT00000012286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNLSPQLCLMPFILGLLSGGVTTTPLSSAQPQGSCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLQTQDQKTVKKAECRAIRCPRPQDFENGEYRPRSPY
YNVSDEISFHCYDGFTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSR
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIILDPSGSMNIYLVLDGSDSIGAGNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATYPRVWVKVSDKESSNADWVTKRLSDINYEDHKLKSGTNTKRALQ
AVYSMMSWPEDIPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVDQVNINALASKKDNEQHVFKVKDMENLEDVFFQMIDESQSLSLCGM
VWEHSKGTDYHKQPWQAKISVTRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGKKRDLEIEKVLFHPDYNISGKKEAGIPEFYDYDVALIKLKNKLNYDPTIRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHVNLFQVLPWLKEKLQDEDLGFL
Download sequence
Identical sequences ENSPANP00000012347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]