SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012360 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012360
Domain Number 1 Region: 4172-4389
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.2e-77
Family Fibrinogen C-terminal domain-like 0.00000276
Further Details:      
 
Domain Number 2 Region: 1309-1477
Classification Level Classification E-value
Superfamily Fibronectin type III 6.31e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 3907-3995
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-18
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 3995-4156
Classification Level Classification E-value
Superfamily Fibronectin type III 6.31e-18
Family Fibronectin type III 0.0000042
Further Details:      
 
Domain Number 5 Region: 2773-2864
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 6 Region: 2229-2320
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 7 Region: 1825-1910
Classification Level Classification E-value
Superfamily Fibronectin type III 2.27e-17
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 3205-3296
Classification Level Classification E-value
Superfamily Fibronectin type III 3.15e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 9 Region: 3512-3670
Classification Level Classification E-value
Superfamily Fibronectin type III 3.65e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 10 Region: 2998-3080
Classification Level Classification E-value
Superfamily Fibronectin type III 4.81e-17
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 11 Region: 2454-2537
Classification Level Classification E-value
Superfamily Fibronectin type III 5.41e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 12 Region: 3314-3404
Classification Level Classification E-value
Superfamily Fibronectin type III 6.23e-17
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 13 Region: 2882-2972
Classification Level Classification E-value
Superfamily Fibronectin type III 6.47e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 14 Region: 2338-2428
Classification Level Classification E-value
Superfamily Fibronectin type III 8.13e-17
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 15 Region: 3098-3188
Classification Level Classification E-value
Superfamily Fibronectin type III 9.02e-17
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 16 Region: 3809-3903
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-16
Family Fibronectin type III 0.00000215
Further Details:      
 
Domain Number 17 Region: 2674-2756
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-16
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 18 Region: 1726-1815
Classification Level Classification E-value
Superfamily Fibronectin type III 1.82e-16
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 19 Region: 760-921
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000103
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 20 Region: 3419-3508
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000116
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 21 Region: 1623-1705
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000123
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 22 Region: 2563-2645
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000159
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 23 Region: 1512-1594
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000199
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 24 Region: 1920-2006
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000498
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 25 Region: 2021-2109
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000714
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 26 Region: 3712-3794
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000824
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 27 Region: 2132-2214
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000221
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 28 Region: 1087-1173
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000373
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 29 Region: 1206-1289
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000151
Family Fibronectin type III 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012360
Domain Number - Region: 624-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 253-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 284-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00285
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 315-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Integrin beta EGF-like domains 0.054
Further Details:      
 
Domain Number - Region: 377-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 191-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00553
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 594-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00737
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 532-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 470-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00954
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 439-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Integrin beta EGF-like domains 0.059
Further Details:      
 
Domain Number - Region: 563-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 501-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0368
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 345-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0402
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 408-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family Integrin beta EGF-like domains 0.081
Further Details:      
 
Domain Number - Region: 222-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0536
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 723-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family Integrin beta EGF-like domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012360   Gene: ENSPANG00000014564   Transcript: ENSPANT00000015962
Sequence length 4396
Comment pep:known_by_projection chromosome:PapAnu2.0:4:31335312:31391605:-1 gene:ENSPANG00000014564 transcript:ENSPANT00000015962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPAQYALTSSLALLVLLGTARAGPFSSRSNVTLPAPRPPPQPGGRTVGAGGGRPSSQLY
EHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVPASEVQALRVRLEILEELVKGLKEQ
CTGGCCPTAAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
GPDCSQRSCPRGCSQRGRCEDGRCVCDPGYTGEDCGMRSCPRGCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQRGRCEDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
CWPGYTGLDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
CVCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGSCED
GVCVCDPGYSGEDCSTRSCPGGCRGRGQCIDGRCVCEDGYSGEDCSVRRCPNDCSQHGVC
QDGVCICWEAYVGEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRG
RCVQGVCMCHVGYGGEDCGQEEPPASACPGGCGPRELCQAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPAIEGMRMHLLEETTVRTEWTPAPGPVDAYE
IQFTPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGPPASKTITTMI
DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTAPGHYSYPEVRPPAPPPKARPRPAPAPRPPRPPR
PSRPAEEGEEESSPRPSLSQPPRRPWGNLTAELSRFRGTVQDLERHLRVHGYPLRANQTY
TSVARHIHEYLQRRLLAAAPAGSPAPLTRHPRPTASPDPGTRKRDSNQGIYGLSPEGVDR
VAAPRHPKPEVLGSSADGALLVSLDGLRGQFERVVLRWRPQPPAEGPGGELTVPGTTRTV
SLPDLRPGTTYHVEVHGVRAGQTSKSYAFITTTGSSPSGLLGTTDEPPPSGPSTTQGAQA
PLLQQRPQELGELRVLGRDETGRLRVVWTAQPDTFAHFQLRLRVPEGPGAHEEVLPGDVR
QALVPPPAPGAPYELSLRGVPPGGKPSDPVIYQGIMDKDEEKPGKSSGPPRLGELTVTDR
TSDSLLLRWTVPEGEFDSFVIQYKDRDGQPKVVPVEGPQRSAVITSLDPGRKYKFVLYGF
VGKKRHGPLVTEAKILPQSDPRPGTPPRLGNLWVTDPTPESLHLSWTVPEGQFDTFMVQY
RDKDGRPQVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEP
PRPEFLEQPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENE
VTVPGLDPDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELGTEAPESSEEP
LLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGEESEVTVGGLEPG
HKYKMHLYGLHEGQRLGPVSAVGVTAPRQEETPPATKPPLEPRLGELTVTDVTPNSVGLS
WTVPEGQFDSFMVQYKDKDGQPQAVPVAADQQEVTIYNLEPERKYKMNMYGLHDGQRVGP
LSVVIMTAPLPPAPATEASEPPLEPRLGELTVTDVTPDSVGLSWTVPEGEFDSFVVQYKD
RDGQPQVVPVAADQREVTIPGLEPSRKYKFLLFGIQDGKRRSPVSVEAKTAARGDASPGA
PPRLGELWVTDPTPDSLHLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTIAPLDA
GRKYRFLLYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTSVTQNSVG
LSWTVPEGQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHSGKRV
GPISAVAITARREDTETETTAPTPPAPEPRLGELTVEEATPHTLHLSWMVTEGEFDSFEI
QHTDREGQLQTVRTGGDRNDVTLSGLESDHRYLVTLYGFRDGKHVGPVHVEALTVPEEEE
PSEPPTTTPEPPITPHLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGRPKAVRV
PGHEDGVTISGLEPDHKYKMNLYGFHGGQRMGPVSAIGVTAAEEETPSPTELGTEAPEPP
EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTIGGL
EPGHKYKMHLYGLHEGQRVGPVSAVGVTAPGKDEEMAPVPTEPPTPEPPIKPRLGELTMT
DATPDSLSLSWTVPEGQFDHFLVQYKNGDGQPKTTRVPGHEDRVTISGLEPYHKYKMNLY
GFHGGQRVGPVSAIGVTAAEEETPSPTELGTEAPEPSEEPLLGELTVTGSSPDSLSLSWT
VPQGHFDSFTVQYKDRDGRPQVVRVGGEESEVTVGSLEPGHKYKMHLYGLHEGRRVGPVS
AVGVTAPREDVDETPSPTEPGTEAPETPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSF
TVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYKMHLYGLHEGQRLGPVSAVGITAPED
EAEATQAVPTTTPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPK
AVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPMSVIGVTAAEEETPSPTEPSTEA
PEPPEEPFLGELTVTGSSPDSLSLSWTVPQGHFDSFTVQYKDRDGRPQVVRVGGEESEVT
VGGLEPGRKYKMHLYGLHEGRRVGPVSAVGVTAPEDEAEATQAVPTATPELPIKPRLGEL
TVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKM
NLYGFHGGQRMGPMSVIGVTAAEEETPAPTEPSTEAPEPPEEPLLGELTVTGSSPDSLSL
SWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYKMHLYGLHEGRRVG
PVSAVGVTAPEDEAETTQAAPTTTPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHF
LVQYRNGDGQPKAVRVPGHEDGVTISGLDPDYKYKMNLYGFHGGQRVGPMSVIGVTVAEE
ETPSPTEPSSEAPEPPEEPLLGEVTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGQPQ
AVRVGGEESEVTVRGLEPGRKYKMHLYGLYEGRRVGPVSTVGVTAPLPTPPPVEPRLGEL
TVAAVTSDSVGLSWTVAQGPFDSFLVQYRDTQGQPQAVPVSGDLRAVTVSGLDPARKYKF
LLFGLQNGKRHGPVPVEARTAPDTKLSPRLGELTVTDATPDSVGLSWTVPEGEFDSFVVQ
YKDKDGRLQVVPVAADQREVTVPGLEPSRKYKFLLYGLAGRKRMGPISADGTTASLEKEP
PPRLGELTVTEETSSSLHLSWTVAQGPFESFVVQYRDTDGQPRAVPVAADQHTVTIEDLE
PGKKYKFLLYGLVGGKRLGPVSALGMTAPEEDTPAPELAPEAPEPPEEPRLGVLAVTDTA
PDSMRLSWSVAQGPFDSFVVQYEDTNGQPQALLVDGDQSKILISGLEPSTPYRFLLYGLH
EGKRLGPLSAEGTTGPAPAGQTSGEPGPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLR
FGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRDLRPGTLYSLTLYGLRGPHKADSIQGT
ARTLSPVLESPRDLQFSEIRETSAKVNWMPPPSRADSFKVSYQLADGGEPQSVQVDGRAR
TQKLQGLIPGARYEVTVVSVRGFEESEPLTGFLTTVPDGPTQLRALNLTEGFAVLHWKPP
QNPVDTYDVQVTAPGAPPLQAEAPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASIT
FTTGLEAPRDLEAKKVTPRTALLTWTEPQVRPTGYLLSFDTPGGRTQEILLPGGVTSHQL
LGLFPSTPYNARLQAMWGESLLPPVSTSFTTGGLRIPFPRDCGEEMQNGAGASRTTTIFL
NGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALH
SLTQAGDYSMRVDLRAGDEAVFAQYDSFRVDSAAEYYRLHLEGYHGTAGDSMSYHSGSVF
SARDRDPNNLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFT
EMKLRPRNFRSPAGGG
Download sequence
Identical sequences ENSPANP00000012360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]