SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012377 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012377
Domain Number 1 Region: 27-109
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.14e-28
Family MHC antigen-recognition domain 0.00000677
Further Details:      
 
Domain Number 2 Region: 109-205
Classification Level Classification E-value
Superfamily Immunoglobulin 2.19e-24
Family C1 set domains (antibody constant domain-like) 0.00000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012377   Gene: ENSPANG00000018202   Transcript: ENSPANT00000000039
Sequence length 254
Comment pep:known_by_projection chromosome:PapAnu2.0:4:31733235:31742239:1 gene:ENSPANG00000018202 transcript:ENSPANT00000000039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGVPVLGFFITAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNNTPITNVPPEVTVLTNS
PVELGEPNVLICFIDKFSPPVVNVTWLQNGKPITTGVSETVFLPREDHLFRKFHYLPFLP
STEDIYDCKVEHWGLDAPLLKHWEFDAQSPLPETTENVVCALGLIVGLVGIIVGTIFIIK
GVRKSNAAERRGPL
Download sequence
Identical sequences A0A2I3NCW8
ENSPANP00000012377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]