SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012407 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012407
Domain Number 1 Region: 255-527
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-78
Family Nuclear receptor ligand-binding domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 203-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012407
Domain Number - Region: 176-216
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0131
Family Hydrophobin II, HfbII 0.014
Further Details:      
 
Domain Number - Region: 119-128
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012407   Gene: ENSPANG00000018527   Transcript: ENSPANT00000020307
Sequence length 533
Comment pep:known_by_projection chromosome:PapAnu2.0:4:32452090:32459089:-1 gene:ENSPANG00000018527 transcript:ENSPANT00000020307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYP
EQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences A0A096NHF9 K7BZF6 P28702 Q5STP9
9606.ENSP00000363812 ENSP00000363812 ENSP00000372704 ENSP00000402506 ENSP00000410468 ENSP00000411238 ENSP00000415199 ENSPANP00000012407 ENSP00000363812 ENSP00000372704 ENSP00000402506 ENSP00000410468 ENSP00000411238 ENSP00000415199 gi|11415052|ref|NP_068811.1| NP_068811.1.87134 NP_068811.1.92137 XP_001168893.1.37143 XP_003808638.1.60992 XP_005553391.1.63531 XP_011727380.1.29376 XP_011832049.1.47321 XP_011932208.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]