SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012414 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012414
Domain Number 1 Region: 158-282
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-35
Family Synaptotagmin-like (S variant) 0.00000177
Further Details:      
 
Domain Number 2 Region: 333-450
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.84e-27
Family Protein kinases, catalytic subunit 0.0000238
Further Details:      
 
Domain Number 3 Region: 25-87
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.33e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 4 Region: 98-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.33e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012414   Gene: ENSPANG00000019233   Transcript: ENSPANT00000006474
Sequence length 466
Comment pep:known_by_projection chromosome:PapAnu2.0:20:21508627:21852208:1 gene:ENSPANG00000019233 transcript:ENSPANT00000006474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAELPSVCSSYRVRASFTVT
Download sequence
Identical sequences ENSPANP00000012414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]