SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012423 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012423
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-58
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 242-435
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012423   Gene: ENSPANG00000009108   Transcript: ENSPANT00000012383
Sequence length 870
Comment pep:known_by_projection chromosome:PapAnu2.0:20:22600797:22698790:-1 gene:ENSPANG00000009108 transcript:ENSPANT00000012383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSVCHHSHKRLVACFQGQHGTDAEKRHK
KLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIVDPLYGIA
EVEIPNIQKQRKQLAKLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKV
EQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAHQDKWAEK
PAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLKAALDCST
SHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKL
PPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKNEGTLAEMAAATSVHV
VAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPNSNHSSHTGNDSDSGTLERKRPASMAV
MEGDLMKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTMAPAGPEPPPQSS
RAESSSGGGTVPSSAGILEQGPSPGDGSPPKPKDPATAAAPAPGRNNSQIASGQNQAQAA
AGSHQLSLGPPHSAAGPSPHTLRRAAVKKPAPAPPKPGNPPPGHPGGQSSSGTSQHPPSL
SPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPTQATPLM
HTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLAGGNLET
AQPHAGTLPRPRPVPKPRNRPSVPPGVHSAGDSSLTNAAPTASKIVTDSNSRVSEPHRSI
FPEMHSDPASKDVPGRILLDIDNDTESTAL
Download sequence
Identical sequences ENSPANP00000012423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]