SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012479 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012479
Domain Number 1 Region: 266-380
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-32
Family Pleckstrin-homology domain (PH domain) 0.0000772
Further Details:      
 
Domain Number 2 Region: 523-626
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-25
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 24-82
Classification Level Classification E-value
Superfamily Phenylalanine zipper 2.22e-21
Family Adapter protein APS, dimerisation domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012479   Gene: ENSPANG00000021153   Transcript: ENSPANT00000018914
Sequence length 755
Comment pep:known_by_projection chromosome:PapAnu2.0:20:26176999:26187106:-1 gene:ENSPANG00000021153 transcript:ENSPANT00000018914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGAPKPSTAGSKGSPSPPPGAHHSWREFCESHARAAALDFARRFRLYLASHPQYAGPGAE
AAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEISPHDLSLESCRVGGPLAVLG
PSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPSS
TGPLETSSGPPVLGGNSNSNSSGGAGTIGRGLGSDGPSPGERWTHRFERLRLSRGGGALK
DGAGMVQREELLSFMGAEEAAPDPAGVGRGGGAAGPPSGGGGQPQWQKCRLLLRSEGEGG
GGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYILETVDA
QHVKAWVSDIQECLSPGPCPTTSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQ
DLMLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEG
PPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLV
LTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDML
EHFRVHPIPLESGGSSDVVLVSYVPSSQRQQEPNTSHDPPQPPEPPSWTDPPQPGAEEAS
RAPEVAAAAAAAAKERQEKEKAGGGGVPEELVPVVELVPVVELEEAIAPGSEAQGAGSGG
DSGVPPMVQLQQSPLGSDGEEGGHPRAINNQYSFV
Download sequence
Identical sequences ENSPANP00000012479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]