SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012507 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012507
Domain Number 1 Region: 546-578,717-791
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000345
Family Anti-sigma factor antagonist SpoIIaa 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012507   Gene: ENSPANG00000018480   Transcript: ENSPANT00000010418
Sequence length 974
Comment pep:known_by_projection chromosome:PapAnu2.0:4:35239355:35313578:-1 gene:ENSPANG00000018480 transcript:ENSPANT00000010418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLERSAISGFSSKSRQSSFPYDVKREVYNEETFQQEHKRKASSSGNMNINITTFTHRV
QCRCSWHRFLRCMLTIFPFLEWMCMYRLKDWLLGDLLAGISVGLVQVPQGLTLSLLARQL
IPPLNIAYAAFCSSVIYVIFGSCHQMSIGSFFLVSALLINVLKISPFNNGHLVMGSFLKD
EFSAPSYLMGYNKSLSVVATTTFLTGIIQLIMGVLGLGFIATYLPESAMSAYLAAVALHI
MLSQLTCIFGIMISFHAGPISFFYDIINYCVALPKANSTSILLFLTVVVALRINKCIRIS
FNQYPIEFPMELFLIIGFTVIANKITMATETSQTLIDMIPYSFLFPVTPDFSVLPKIILQ
AISLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSCVFTGAVARTII
QDKSGGRQQFASLVGAGVMLLLMVKMGHFFYALPNAVLAGIILSNVVPYLETISNLPSLW
RQDQYDCALWMMTFSSSIFLGLDIGLIISVVSAFFITSVRSHRAKILLLGQIPNTNIYRS
VNDYREIITIPGVKIFQCCSSITFVNVYYLKHKLLKEVGMVRVPLKEEEIFSLFNSSDTS
LQGEKICRCFCNCDDLEPLPRILYTERFENKLDPDASSVNLIHCSHFESVNTSQTASEDQ
VPYTVSSMSQKNQGQQYEEVEKVWLPNNSSRNSSPGLPDVAESRGRRSLIPYSDASLLPS
VHTIILDFSMVHYVDSQGLVVLRQICNAFRNANILILIAGCHSSIVRAFERNDFFDTGIT
KTQLFLSVHDAVLFALSRKVIDSSELSIDESETVIRETYSETEKNDNSIYKMSSSFLGSQ
KNVSPGFTKIQQPVEEESELDLELESEQEAGLGLDLDLDRELEPESELEPEMESKAETET
ETEMEPQPETEPEMEPDPKSRSRAHTFPQRHYWPTYHPRTASTQSQTQPRTWSVERRRHP
MDSYSPEGNSNEDV
Download sequence
Identical sequences ENSPANP00000012507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]