SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012515 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012515
Domain Number 1 Region: 591-693
Classification Level Classification E-value
Superfamily Bromodomain 8.9e-33
Family Bromodomain 0.00028
Further Details:      
 
Domain Number 2 Region: 1070-1189
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.56e-19
Family PWWP domain 0.016
Further Details:      
 
Domain Number 3 Region: 205-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.87e-17
Family PHD domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012515
Domain Number - Region: 315-354
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000554
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012515   Gene: ENSPANG00000000910   Transcript: ENSPANT00000006874
Sequence length 1205
Comment pep:known_by_projection chromosome:PapAnu2.0:4:35491162:35524679:1 gene:ENSPANG00000000910 transcript:ENSPANT00000006874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPRRKSRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKI
ITEDELTAQDITECNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFR
MVDSGIQPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEEDLAWLDMVNEKRRVDGHSLVS
ADTFELLVDRLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVH
QECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNKGGAFKQTSDGHWAHVVCAIWIPEVC
FANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFM
KIEPMRETSLNGTIFTVRKTAYCEAHSPPSTATARRKGDSPRSISETGDEEGLKEGDGEE
EEEEEVEEEEQEGQGGVSGPLKGVPKKNKVSLKQKIKKEPEEAGQDTPSTLPLVTVPQIP
SYRLNKICSGLSFQRKNQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDE
KTSAVKEELKYWQKLRHDLERARLLIELIRKREKLKREQVKVQQAAMELELMPFNVLLRT
TLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMRRKLESHLYRTLEEFEEDFNL
IVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYDPERGTHLPESPKLEDFY
RFSWEDVDNILIPENRAHLSPEVQLKELLEKLDLVSAMRSSGARTRRVRLLRREINALRQ
KLAQPPPPQPPSLNKTVSNGELPAGPQGDAAVLEQALQEEPEDDGDRDDSKLPPPPTLEP
TGPAPSLSEQESPPEPPTLKPINDSKPPSRFLKPRKVEEDELLEKSPLQLGSEPLQRLLS
DNGINRLSLMAPDTPGGTPLSGVGRRTSVLFKKAKNGVKLQRSPDRALENGEDHGVAGSP
ASPASIEDERHSRKRPRSGSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSG
GLAFEACSGLTPPKRSRGKPALSRVPFLEGVNGDSDYNGSGRSLLLPFEDRGDLEPLELV
WAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFD
NKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGPHSFV
TSSYL
Download sequence
Identical sequences A0A096NHR7
ENSPANP00000012515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]