SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012543 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012543
Domain Number 1 Region: 104-307
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-57
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 291-425
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-33
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 3 Region: 409-517
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 546-640
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-20
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012543   Gene: ENSPANG00000013431   Transcript: ENSPANT00000009209
Sequence length 655
Comment pep:known_by_projection chromosome:PapAnu2.0:4:36300841:36326144:1 gene:ENSPANG00000013431 transcript:ENSPANT00000009209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEASEEKLASVSNLVTVFENSRTPEAAPRGHRLEDAHHHPECRPPRSPGPWEKLNVGEA
MGSEPRTVSGRYLNSLKNKLSSGAWRKSCQPVTLSGSGMQEPEKKIVQELLETEQAYVAR
LHLLDQVFFQELLRAARRSKAFPEDVVRVIFSNISSIYQFHSQFFLPELQRRLDDWTANP
RIGDVVQKLAPFLKMYSEYVKNFERAAELLATWTEKSPLFQEVLTRIQSSEASGSLTLQH
HMLEPVQRIPRYELLLKEYVQKLPAQAPDRADAQKALDMIFSAAQHSNAAITEMERLQDL
WEVYQRLGLEDDIVDPSNTLLREGPVFKISFRRNDPMERYLFLFNNMLLYCVPRVIQVGA
QFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQRTLELQARSQEEKISWMQAFQAAVDQI
EKRNETFKAAAQGPEGDTQEQELQSEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHH
CRACGYVVCARCSDYRAELKYNDNRPNRVCLHCYTFLTGNVLPEAKEDKRRGILEKGSSA
TPDQSLMCSFLQLIGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVT
VGPQGDPRVFQLQQSGQLYTFKAETEELKGRWMKAMEQAASGWSPSWPNDGDLSD
Download sequence
Identical sequences ENSPANP00000012543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]