SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012562 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012562
Domain Number 1 Region: 138-203
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.88e-19
Family AN1-like Zinc finger 0.0011
Further Details:      
 
Domain Number 2 Region: 18-68
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000171
Family A20-like zinc finger 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012562   Gene: ENSPANG00000024970   Transcript: ENSPANT00000000119
Sequence length 227
Comment pep:known_by_projection chromosome:PapAnu2.0:4:37145041:37488138:1 gene:ENSPANG00000024970 transcript:ENSPANT00000000119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLF
SEETTSDNNNTSITTPTLSPSQQPLPTELNVTSPSKEECGPCTDTAHVSLITPTKRSCGT
DSHSENEASPVKRPRLLENTERSEETSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVF
CMLHRLPEQHDCTFDHMGRGREEAIMKMVKLDRKVGRSCQRIGEGCS
Download sequence
Identical sequences A0A096NHW4 A0A0D9RDY3 A0A2K5M1S1 A0A2K6BP91 A0A2K6L3L4 H9FY55
XP_006882085.1.29581 XP_007937608.1.48129 XP_007970929.1.81039 XP_011929607.1.92194 XP_014991764.1.72884 XP_017725639.1.44346 ENSPANP00000012562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]