SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012563 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012563
Domain Number 1 Region: 436-662
Classification Level Classification E-value
Superfamily RNI-like 1.16e-29
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 2 Region: 81-152
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000399
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012563   Gene: ENSPANG00000019062   Transcript: ENSPANT00000000120
Sequence length 690
Comment pep:known_by_projection chromosome:PapAnu2.0:20:27071030:27094706:1 gene:ENSPANG00000019062 transcript:ENSPANT00000000120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMEVPGKGESGPSALLTPPMSSSSRGPGAGARRRRTRCRRCRACVRTECGDCHFCRDMK
KFGGPGRMKQSCLLRQCTAPVLPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEI
VHPGCLKMGKAEGVINAEIPNCWECPRCTQEGRTSKDSGEGPGRRRADNGEEGASLGSGW
KLTEEPPLPPPPPRRKGPLPAEDVPGPPKRKEREAGNEPPTPRKKVKGGRERHLKKVGGD
ACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGPAVPSPSPQR
EKLERFKRMCQLLERVPDTSSSSSDSDSDSDSSGTSLSEDEAPGEARNGRRPARGSSGEK
ENRGGRRAVRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAAGSDHPL
PRAAWLRVFQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRKSLTPPMLSGVVRRQ
PRALDLSWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLRWIED
VKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDL
SHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLRSCRQ
LSPEACARLAAAGPPGPFRCPEEKLLLKDS
Download sequence
Identical sequences ENSPANP00000012563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]