SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012577 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012577
Domain Number 1 Region: 48-303
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-89
Family Eukaryotic proteases 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012577   Gene: ENSPANG00000009716   Transcript: ENSPANT00000000092
Sequence length 362
Comment pep:known_by_projection chromosome:PapAnu2.0:20:27292565:27294102:-1 gene:ENSPANG00000009716 transcript:ENSPANT00000000092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEQKGQNCPHLGGNKGVLTPVNPLPKLCIRAPGLHRRGQANNLTPSFPPWAAPCGVAP
QARITGGSNAVPGQWPWQVSITYDGVHVCGGSLVSEKWVLSAAHCFPSEHSKESYEVRLG
AHQLDSYSEDVKVSTVKYIIPHPSYLQEGSQGDIALLQLSSPVTFSRYIRPICLPAANAS
FPNGLHCTVTGWGHVAPSVSLLAPKPLQQLEVPLISRETCNCLYNINAKPEEPHFVQEDM
VCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWI
QSKATEIQPRVVRQTQESQPDSNLCSSHLAFNSAPAQGLLRPILFLPLGLALGLLSPWLS
EH
Download sequence
Identical sequences ENSPANP00000012577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]