SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012594 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012594
Domain Number 1 Region: 313-375
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.84e-19
Family LIM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 254-316
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.14e-18
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 372-434
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.77e-16
Family LIM domain 0.0062
Further Details:      
 
Domain Number 4 Region: 431-461
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000993
Family LIM domain 0.01
Further Details:      
 
Domain Number 5 Region: 226-252
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000108
Family LIM domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012594   Gene: ENSPANG00000007359   Transcript: ENSPANT00000018492
Sequence length 461
Comment pep:known_by_projection chromosome:PapAnu2.0:20:27642922:27652134:1 gene:ENSPANG00000007359 transcript:ENSPANT00000018492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLY
STVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKV
ASGEQKEDQSEDKKRPSLPSSPSPGLPKPSATSATLELDRLMASLSDFRVQNHLPASGPT
QPPVASSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVV
TALGRAWHPEHFICGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
ALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISA
LSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSAL
GRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG
Download sequence
Identical sequences A0A096NHZ6
ENSPANP00000012594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]