SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012647 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012647
Domain Number 1 Region: 12-171
Classification Level Classification E-value
Superfamily EF-hand 5.94e-44
Family Calmodulin-like 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012647   Gene: ENSPANG00000018702   Transcript: ENSPANT00000016579
Sequence length 202
Comment pep:known_by_projection chromosome:PapAnu2.0:4:41529101:41534755:1 gene:ENSPANG00000018702 transcript:ENSPANT00000016579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMF
ETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR
AINPCSDTAMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIV
RRLQNGEQDEEGADKEAAEAAG
Download sequence
Identical sequences A0A096NI49 A0A0D9RG45 A0A2K5KQW8 A0A2K5V9T9 A0A2K5YEZ8 A0A2K6BZV7 F6WK47
XP_007970767.1.81039 XP_007970768.1.81039 XP_007970769.1.81039 XP_011752842.1.29376 XP_011752843.1.29376 XP_011752844.1.29376 XP_011752845.1.29376 XP_011752847.1.29376 XP_011842103.1.47321 XP_011842104.1.47321 XP_011842105.1.47321 XP_011928450.1.92194 XP_011928459.1.92194 XP_011928469.1.92194 XP_014991830.1.72884 XP_015304890.1.63531 XP_015304891.1.63531 ENSPANP00000012647 ENSMMUP00000007415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]