SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012682 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012682
Domain Number 1 Region: 59-189
Classification Level Classification E-value
Superfamily PX domain 3.66e-26
Family PX domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012682
Domain Number - Region: 192-280
Classification Level Classification E-value
Superfamily TPR-like 0.00163
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012682   Gene: ENSPANG00000000812   Transcript: ENSPANT00000027218
Sequence length 316
Comment pep:known_by_projection chromosome:PapAnu2.0:20:33147818:33153104:-1 gene:ENSPANG00000000812 transcript:ENSPANT00000027218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPEHPGSPGWKGPITQCTARTQQEAQAAGPDLPHPGPDRQLDMHSGLSSNSSMTTREL
QQYWQNEKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDF
AKLQKALLKTFREEIEDVEFPRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREF
LDFLTRQELREAFGCLRAGQYPRALELLLRVLPLQEKLTAHCPAAAVPALCAVLLCHRDL
DRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYTLGKDFVSLQERLEESQLRRPT
PRGITLKELTVREYLH
Download sequence
Identical sequences A0A096NI84
ENSPANP00000012682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]