SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012699 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012699
Domain Number 1 Region: 298-416,468-491
Classification Level Classification E-value
Superfamily TPR-like 3.86e-26
Family Tetratricopeptide repeat (TPR) 0.0053
Further Details:      
 
Domain Number 2 Region: 219-334
Classification Level Classification E-value
Superfamily TPR-like 3.38e-23
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012699
Domain Number - Region: 111-155
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0123
Family N-terminal coiled coil domain from apc 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012699   Gene: ENSPANG00000007016   Transcript: ENSPANT00000015002
Sequence length 627
Comment pep:known_by_projection chromosome:PapAnu2.0:4:42437399:42451475:1 gene:ENSPANG00000007016 transcript:ENSPANT00000015002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGKVPQARMSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEALHSEHQAVLQSLSQTIE
CLQQGGHEEGLVHEKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRL
CQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLGQLRQYDEDGHTTEEKEGDATK
DSLDDLFPNEEEEDPSNGLSRGQGTAAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVP
LCKQALEDLERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGPDHP
AVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQGK
YEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQAKYAEAETLYKEILTRAHVQ
EFGSVDDDHKPIWMHAEEREEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGA
LYRRQGKLEAAETLEECAQRSRRQGTDPISQTKVAELLGESDGRRTSQEGPGDSVKFEGG
EDASVAVEWSGDGSGTLQRSGSLGKIRDVLRRSSEILVRKLQGTEPRPSSSNMKRAASLN
YLNQPSAAPLQVSRGLSASSMDLSSSS
Download sequence
Identical sequences ENSPANP00000012699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]