SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012724 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000012724
Domain Number 1	Region: 31-78
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000019
Family	LIM domain	0.0014
Further Details:

Domain Number 2	Region: 152-199
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000362
Family	LIM domain	0.0016
Further Details:

Domain Number 3	Region: 4-30
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000183
Family	LIM domain	0.0088
Further Details:

Domain Number 4	Region: 111-151
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000228
Family	LIM domain	0.011
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000012724 Gene: ENSPANG00000007156 Transcript: ENSPANT00000008982
Sequence length	212
Comment	pep:known_by_projection chromosome:PapAnu2.0:4:42678175:42682007:-1 gene:ENSPANG00000007156 transcript:ENSPANT00000008982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSVLSPGGHAEHNGRPYCHKPCYGA LFGPRGVNIGGVGSYLYNAPTPSPGSTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGE TSLCPGCGEPVYFAPAEKVMSLGRNWHRPCLRCQRCRKTLTAGSHAEHDGVPYCHVPCYG YLFGPKGVNIGDVGCYIYDPAPSLEEATQGAP
Download sequence
Identical sequences	ENSPANP00000012724

SEARCH