SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012750 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012750
Domain Number 1 Region: 171-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000123
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 2 Region: 213-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000201
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 134-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000133
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 95-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000271
Family EGF-type module 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012750
Domain Number - Region: 64-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0028
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012750   Gene: ENSPANG00000023628   Transcript: ENSPANT00000008981
Sequence length 383
Comment pep:known_by_projection chromosome:PapAnu2.0:4:42831775:42838305:-1 gene:ENSPANG00000023628 transcript:ENSPANT00000008981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCL
PGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLM
RPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASHPCQRGARCRDRVHDFDCLCPS
GYGGKTCELVLPVPHPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEA
GLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQV
SMLPAGLPLPPDLPPEPGKTTAL
Download sequence
Identical sequences A0A096NIF2
ENSPANP00000012750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]