SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012751 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012751
Domain Number 1 Region: 345-508
Classification Level Classification E-value
Superfamily EF-hand 9.67e-31
Family Calmodulin-like 0.0037
Further Details:      
 
Domain Number 2 Region: 73-317
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000000000000575
Family Glycerol-3-phosphate (1)-acyltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012751   Gene: ENSPANG00000006269   Transcript: ENSPANT00000024180
Sequence length 544
Comment pep:known_by_projection chromosome:PapAnu2.0:20:38015323:38094214:1 gene:ENSPANG00000006269 transcript:ENSPANT00000024180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRCAQAAAVAATVPAAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTHIGSARRVQIFL
LGIILLPIRVLLVALILLLAWPFAAISTVCCPEKLTHPVTGWRRKITQTALKFLGRAMFF
SMGFIVSVKGRIASPLEAPVFVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRMLR
AVQPILVSRVDPDSRKNTINEIIKRTTSRGEWPQILVFPEGTCTNRSCLITFKPGAFIPG
VPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTKVEVEFMPVQVPNDEEKNDPV
LFANKVRNVMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRKLKLDWDGV
RKQLDEYASIASSSKGGRIGIDEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGL
AVLCNPANTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDS
ISYEEFKSFALRHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSIASNKVSPEKHEESASD
KKDD
Download sequence
Identical sequences A0A096NIF3
ENSPANP00000012751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]