SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012760 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012760
Domain Number 1 Region: 264-321
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.65e-17
Family PHD domain 0.0016
Further Details:      
 
Domain Number 2 Region: 168-238
Classification Level Classification E-value
Superfamily SAND domain-like 0.000000000000436
Family SAND domain 0.019
Further Details:      
 
Domain Number 3 Region: 409-460
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000155
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012760   Gene: ENSPANG00000020902   Transcript: ENSPANT00000005565
Sequence length 527
Comment pep:known_by_projection chromosome:PapAnu2.0:3:2415132:2427053:-1 gene:ENSPANG00000020902 transcript:ENSPANT00000005565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEMGRPQGVGDRGRDPHATPLQETLRLKEKEGCPQAFHALLSWLLTQDSTVILDFWRVL
FKDYNLERYGRLQPILDSFPKDVDLSQSRKGRKLPTIPKALVPPPRHPTKRKASEEPRAA
APAALTPRGTPSPGSQLKAKPPRKAESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPG
ARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDPSGGKNKARSGGGLKPLVRAKGA
QGAAPGGDEARLGQQGRAPALPALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLA
CLSPPLREIPSGTWRCSGCLQVTVQETQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPP
GEPLTGMDTALVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQSPAPGARCGVCGDGT
DVLRCAHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDMTPAPVEGVLAPSPAHLAPGPAK
DDTASHEPTLHREDLESLLSEHTFDGILQWAIQSMARPLAEAAPFPS
Download sequence
Identical sequences ENSPANP00000012760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]