SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012782 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012782
Domain Number 1 Region: 61-133
Classification Level Classification E-value
Superfamily Ribosomal protein S18 3.4e-22
Family Ribosomal protein S18 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012782   Gene: ENSPANG00000006967   Transcript: ENSPANT00000008100
Sequence length 196
Comment pep:known_by_projection chromosome:PapAnu2.0:4:43048927:43065338:-1 gene:ENSPANG00000006967 transcript:ENSPANT00000008100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFKGLVSAYGGLLRGLLAGPAATSWSRLPARGFREVVEIQEGKTTIIEGRLTATPKGS
PNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVK
MAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNKVCMPVGSPL
LRDNVCYSRTPWKLYH
Download sequence
Identical sequences A0A096NII4 A0A0D9RI76 A0A2K5TSW2 H9FWJ2
NP_001244564.1.72884 XP_005552952.1.63531 XP_007970625.1.81039 ENSPANP00000012782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]